SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033579 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033579
Domain Number 1 Region: 584-803,830-931
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.25e-65
Family Pancreatic carboxypeptidases 0.00000567
Further Details:      
 
Domain Number 2 Region: 409-566
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.32e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00014
Further Details:      
 
Domain Number 3 Region: 931-1023
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 4.12e-21
Family Carboxypeptidase regulatory domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033579   Gene: ENSBTAG00000012237   Transcript: ENSBTAT00000033669
Sequence length 1170
Comment pep:known chromosome:UMD3.1:4:77881913:77891706:-1 gene:ENSBTAG00000012237 transcript:ENSBTAT00000033669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLGAPLLGCLLVLLALCPGGRPQTVLTDDEIEEFLEGFLSELESEPREDDVEAPPPP
EPTLPARKPQTGGKPGARPGVAEEVPPGKAKDKGKKGKKDKSPKATKQPPEGSSRPPKKP
KEKPPKEKPPKATKKPKEKPPKATKKPKEKQPKEKPPKEKPPKEKPPKATKKPKEKPPKA
TKRPLAGKKLSIPTPSESPQWPLPPLLSPDHEELPQEGGGPLPDPWGGPGEETDVEHQPE
PEEETEQPTLDYNDQIEREDYEDFEYIRRQKQPRPPPSRRRPERPWPERPEEKAEPPGRG
FEAPEEKIEPPPLKPLPPPLLPDYEDGYVIPNYDDMDYYFRPPKPQKPDTGLETDEEKEE
LKKPKKEGSSPKEEETDDKWTVEKGKDPKGPRKGEESEEEWAPVEKISCRXIGMESHRIE
DNQIRASSMLRHGLGAQRGRLNMQAGDTEDDYYDGAWCAEDDSQTQWIEVDTRRTTKFTG
VITQGRDSSIHDDFVTSFFVGFSNDSQTWVMYTNGYEEMTFHGNVDKDTPVLSELPEPVV
ARFIRIYPLTWNGSLCMRLEVLGCPVSPVHSYYAQNEVVTTDDLDFRHHNYKDMRQLMKV
VNEQCPTITRTYSLGKSSRGLKIYAMEISDNPGDHELGEPEFRYTAGIHGNEVLGRELLL
LLMQYLCREYRDGNPRVRSLVQDTRIHLVPSLNPDGYEVAAQMGSEFGNWALGLWTEEGF
DIYEDFPDLNSVLWGAEERKWVPYRVPNNNLPIPERYLSPDATVSTEVRAIIAWMEKNPF
VLGANLNGGERLVSYPYDMARTPSQEQLLAAAMAAARGEDEEEVSEAQETPDHAIFRWLA
ISFASTHLTMTEPYRGGCQAQDYTGGMGIVNGAKWKPRSGTINDFSYLHTNCLELSIFLG
CDKFPHESELPREWENNKEALLTFMEQVHRGIKGVVTDEQGIPIANATISVSGINHGVKT
ASGGDYWRILNPGEYRVTAHAEGYTPSSKTCNVDYDIGATQCNFILARSNWKRIREIMAM
NGNRPIPRIDPSRPMTPQQRRMQRRRLQYRLRMREQMRLRRLNATTSPATTPTSPPPTPT
LLPTADLAPSPAPSSTLGPWQFLPETTVNWEESETETETETETYTEVVTEFGTELGPEEE
EGEEGEGEMVTGPDFPFTTVETYTVNFGDF
Download sequence
Identical sequences F1N1C7
ENSBTAP00000033579 ENSBTAP00000033579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]