SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033613 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033613
Domain Number 1 Region: 147-267
Classification Level Classification E-value
Superfamily FKBP-like 1.28e-38
Family FKBP immunophilin/proline isomerase 0.00041
Further Details:      
 
Domain Number 2 Region: 37-158
Classification Level Classification E-value
Superfamily FKBP-like 3.93e-38
Family FKBP immunophilin/proline isomerase 0.0002
Further Details:      
 
Domain Number 3 Region: 271-382
Classification Level Classification E-value
Superfamily FKBP-like 1.79e-36
Family FKBP immunophilin/proline isomerase 0.00031
Further Details:      
 
Domain Number 4 Region: 377-482
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-33
Family FKBP immunophilin/proline isomerase 0.00036
Further Details:      
 
Domain Number 5 Region: 495-563
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000363
Family Calbindin D9K 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033613   Gene: ENSBTAG00000016707   Transcript: ENSBTAT00000033703
Sequence length 574
Comment pep:known chromosome:UMD3.1:4:64209775:64252100:-1 gene:ENSBTAG00000016707 transcript:ENSBTAT00000033703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIRARSWRPPPPPLLLLLLWVTGQAAPVAGLGLGSDSELQIERRFVPEECPRTVRSGDF
VRYHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLIAGMDQALVGMCVNERRFVKIPPKLA
YGSDGVSGVIPPDSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGT
FLDGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGK
DIPGQASLVFDVALLDLHNPKDGISIENKVVPENCERRSQSGDFLRYHYNGTLLDGTFFD
SSYSRNRTFDTYIGQGYVIPGIDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLV
FDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTY
NIVLGFGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLEL
VAGLPEGYMFVWNGEVSANLFEEIDKDGDGEVLLEEFSEYIHAQVASGKGKLAPGFDAEM
IVKNMFTNQDRNGDGKVTAEEFKLKDQETKHDEL
Download sequence
Identical sequences Q2KJC8
9913.ENSBTAP00000033613 ENSBTAP00000033613 NP_001039837.1.59421 NP_001039837.1.76553 XP_019814350.1.53367 ENSBTAP00000033613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]