SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033782 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033782
Domain Number 1 Region: 420-751
Classification Level Classification E-value
Superfamily L domain-like 1.59e-64
Family Internalin LRR domain 0.014
Further Details:      
 
Domain Number 2 Region: 142-454
Classification Level Classification E-value
Superfamily L domain-like 4.42e-56
Family Leucine rich effector protein YopM 0.039
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000033782
Domain Number - Region: 762-853
Classification Level Classification E-value
Superfamily DEATH domain 0.0746
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033782   Gene: ENSBTAG00000001571   Transcript: ENSBTAT00000033876
Sequence length 863
Comment pep:known_by_projection chromosome:UMD3.1:4:9334914:9351034:-1 gene:ENSBTAG00000001571 transcript:ENSBTAT00000033876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKKRTSEELEDIISRYRKESRSRSVEESGLTKETSNLLKEDSDETSSNQIYETHPSKN
TLASSSGSKSKKNEEQRKSLQFSETITTYDSLQSKTGISQNSSLSETEMRAEYQAFVDSL
SHETLGKISPQLSEENQKGSGLPSDNFTINLKAKGLQEFPKDILKVKYVKYLYLDENEIK
SFKGADSRDMLGLEILSIQKNGLSTLPSEIQLLHNLKLLNVSYNQISHIPKEISQLGNIK
ELFLNNNCIEDFPSGLESLKNLEILNLAKNKLRHIPDALSSLKNLRALNLEYNRLTIFPK
ALCFLPKLISLNLTGNLINSLPKEIKELKNLEKLLLDHNKLTFLAVEIFLLLKMKELQLT
DNKLEVISNKIENFKELRILILDKNLLKDMPENISHCAVLECLSLSDNKLTELPKNIHKL
KNLRKLHINRNYLVKIPEYISHLNNMFSLEFSGNFITDFPIEIKSCKNIAKVELSYNKIM
YFPLGLCALDSLHYLSLNGNYISEIPVDISFNKQLLHLEFNENKLLLFSEHLCSLINLEY
LDLGKNKIRKIPPSISNMVSLHVLILCYNKLETFPTEVCTLDNLRVLDLSENQIQTIPSE
ICNLKGIQKLNISNNQFIYFPVELCHLQSLEELNISQINGKKLTRLPEELSNMTKLKGLD
ISNNAIREMPTNIGELRSLVSLNADNNQIRYLPSSFLSLNALQQLNLSGNNLSVLPSGIY
NLFSLKEINFDDNPLLRPPMEICKGKQLYTIARYLQRADERDEKILAKIFKIVAKNITET
HFQFLCQKLNLTISESDKSALSTVSLSERVHQVLDKWKMEKNNLSVTTAALRDQLTRALT
MIGAYEIMDKITALKLFSCAIKF
Download sequence
Identical sequences E1BPT0
NP_001192376.1.59421 NP_001192376.1.76553 ENSBTAP00000033782 9913.ENSBTAP00000033782 ENSBTAP00000033782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]