SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033786 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033786
Domain Number 1 Region: 462-677
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.7e-27
Family Laminin G-like module 0.0087
Further Details:      
 
Domain Number 2 Region: 690-891
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-24
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 3 Region: 890-914,970-1117
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.87e-24
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 186-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000566
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 5 Region: 1299-1339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000967
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 6 Region: 148-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000294
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 7 Region: 224-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000544
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 8 Region: 303-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 262-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000383
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 10 Region: 1141-1187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000495
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 11 Region: 1203-1335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000471
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 12 Region: 112-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000157
Family EGF-type module 0.02
Further Details:      
 
Domain Number 13 Region: 379-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 14 Region: 71-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000196
Family Laminin-type module 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033786   Gene: ENSBTAG00000008944   Transcript: ENSBTAT00000033880
Sequence length 1408
Comment pep:known chromosome:UMD3.1:16:78094758:78320235:1 gene:ENSBTAG00000008944 transcript:ENSBTAT00000033880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRTVNHRLLLCLSLSLLISIKSSFCNKNDTKCLSDSCQKNSTCKDFSKDKSCRCSDTA
VHGDKDCGEEEDPCLSSPCPGHATCARVPGERRSRCRCPPGHSGAGCDTAAGPCGPRSCL
HGGVCHQDPGPPVCVCPAGYAGRFCELDLDECASSPCLHGAMCQDRGDGYSCFCVPGYQG
RHCDVEVDECVSEPCRNAATCLNEIGRYTCLCPRGFSGVNCELEVDECWSQPCLNGATCR
DAAGAYFCDCAPGFLGDHCELNTDECASGPCLHGGLCVDGANRYSCTCAGSGFTGTRCET
LLPPCWSEPCHNNAICEDSADRYTCRCRPGYTGAQCETDLDGCGSGPCQAGGRCVELSSE
TGRERLARLLSASRRPEASGYVCICPPGLTGVHCEEDVDECLSSPCRNGGTCENSPEGYT
CHCPFDPHSGVFFGGRDCSDILLGCADHPCLNNGTCVPHVHDGQHGFDCLCPPGYTGSRC
GTVTTLSFLGSGFLWVSSGSALAQDSGCTVALRFQTVQPAALLLFRGDRDVFVMLEVLAG
FVHLTVQVSDRPKVVLLIPHDTSDGGWHAVEATFAEAVTLALRDDSCMGTCVARAPSPFE
SDGSSACALQNSFLGGLPEGRAHSGDALLNVYRIPSAPSLVGCLQDVHLDSNAITAENVS
SDQSLNVKAGCARKDWCESQPCRNRGRCLNLWLGHRCECYRPYRGRSCHGEYVAGRFGQD
DSPGYAVFHLNKDYEEDLTLSMFVRTRRPTGLLLALGNGTYQYLRVWLEHGRLAMLTPGS
PKLLVTFVLSDGNVRLVSLKIKPNKIELYESSQNLGFLSAPTWKLQRGDVLYVGGLPDRR
ETEVSGGFFKGCIQDMRLNNENLEFFPNPTSSAAHNAVLVNVTEGCPGDNLCEPNPCHHG
GICYPLWDDFSCSCPVNTAGKACQELRWCELGPCPPGAQCLRLPRGFECIANAVFNGQSR
EIIFRSNGNITRELTNVTFGFRTRDAHAIILHAEKEPEFLRIHIQDSRLLFQLRSGNSFY
TLSLTSLQPVSDGVWYQVTISMTDPGAQASRWQMEVDGQTPPVTSAVAAGSLSFLKDDTD
VYVGDRASDSTRALRGCLSTIAISGLYLSYFENVRGLMNRPQEERFLKVSRPPVETGCLQ
LDACRSGPCLHGGRCEDTYSSHRCTCPAGRSGPHCEFHVDECLSSPCIHGNCSAPGGTAY
HCRCEPGFTGVNCESEVDHCQHHQCANGATCVSDANGYSCRCPGNFTGRFCRYLRLPSTV
CGNEKANLTCYNGGNCTAFQGEMKCACGPGFTGERCDKDIDECASDPCLHGGRCHDLLNG
FRCVCALAFAGPRCELDLADDLLSDVFTTIGSVTLALLLILFLAVVASVLASNKRATQGS
YSPSRQEKDSSRVEMWSVMDAPAAERLI
Download sequence
Identical sequences F1N3A5
ENSBTAP00000033786 ENSBTAP00000033786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]