SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033855 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000033855
Domain Number - Region: 229-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 232-365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0659
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number - Region: 363-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0661
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033855   Gene: ENSBTAG00000012405   Transcript: ENSBTAT00000033952
Sequence length 1040
Comment pep:known chromosome:UMD3.1:3:13986478:14007210:-1 gene:ENSBTAG00000012405 transcript:ENSBTAT00000033952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPLRALLLLALELGLAATLNPKDPNTCSFWESFTTTTKESLSRPFSLLPSEPCSRPWE
SPHTCPRPTVVYRTVYRQVVKTEHRMRLQCCRGFYESRGACVPLCAQECVHGRCVAPNQC
QCVQDWRGDDCSSACAPGVWGPKCDKPCNCGNSSSCDPKSGACSCPSGLQPPHCLQPCSP
GLYGPACQFSCQCHGAPCNPQTGACLCPPERTGPTCEVSCSPSSVGFSCPSTPPCQNGGV
FQASQDSCSCPPGWTGTICSLPCPEGFHGPNCSQECRCHNGGLCDRFTGQCRCAPGYTGD
RCREECPVGRFGQDCAETCDCAPGARCFPANGACLCEHGFTGDRCAERLCPDGLYGLSCQ
VPCTCDPEHSLSCHPMSGECSCLPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGVCQPDS
GLCRCAPGYTGPHCASLCPPDTYGVNCSQRCSCENAIACSPIDGTCVCKEGWQRGNCSVP
CPPGTWGFGCNASCQCAHEAACSPQTGACTCTPGWHGTNCQLPCPKGQFGEGCASRCDCD
HADGCDPVHGHCQCQAGWTGTRCHQPCPEGFWGANCSNACACRNGGTCIPKNGNCVCAPG
FRGPFCQKSCQPGRYGKRCVPCKCANHSSCHPSNGTCYCLAGWTGPDCSQPCPLGHWGAN
CAQLCQCRHGGTCHPQDGSCFCPPGWTGHLCLEGCSPGMFGANCSQPCQCGPGERCHPET
GACVCPPGHSGAPCRIGSQEPITMMPTPPVAYNSLGAVIGIAVLGSLVVALVALFIGYRH
WQKGKEHQHLAVGYSSGRLDGSEYVMPDVPPSYSHYYSNPSYHTLSQCSPNPPPAKKVPG
SQLFASLQASERPGGAHGLDNHATLPADWKHRREPPAGPLDRGSSRLDRSYSCSYSNSNG
PGPFYSKGPISEEGLGASMASLSSENPYATIRDLPSLLGSPRESSYVEMKGPSSGSPPRQ
LPQLPDSQRRRHPQPQRDSGTYEQPSPLVHDRDSVGSQPPLPPGLPPGHYDSPKNSHIPV
HYDLPPVRHPPSPPVRRQDR
Download sequence
Identical sequences A6QP76
9913.ENSBTAP00000033855 ENSBTAP00000033855 NP_001094770.1.59421 NP_001094770.1.76553 XP_005203840.1.76553 XP_010801251.1.76553 XP_010801252.1.76553 ENSBTAP00000033855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]