SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033996 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033996
Domain Number 1 Region: 12-490
Classification Level Classification E-value
Superfamily ALDH-like 3.01e-169
Family ALDH-like 0.00000000000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033996   Gene: ENSBTAG00000017852   Transcript: ENSBTAT00000034095
Sequence length 494
Comment pep:known_by_projection chromosome:UMD3.1:3:3252171:3281221:1 gene:ENSBTAG00000017852 transcript:ENSBTAT00000034095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGTFVVSQPLNYRGGARVEPVDASGTEKAFEPATGRVIATFTCSGEKEVNLAVQDAKA
AFKIWSQKSGMERCRILLEAARIIRERRDEIATMETINNGKSIFEARWDIDTSWQCLEYY
AGLAGSMAGEHIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIACWKSAPALACGNAMVFK
PSPFTPVSVLLLAEIYTEAGVPPGLFNVVQGGAATGQFLCQHRDVAKVSFTGSVPTGSKI
MEMSAKGIKPVTLELGGKSPLIIFSDCDMKNAVKGALMANFLTQGEVCCNGTRVFVQKEI
LDQFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDVF
VPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFDTEAEVLERANDTTFGLA
AGVFTRDIQRAHRVVAELQAGMCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQL
KTVCVEMGDVESAF
Download sequence
Identical sequences F1N2L9
ENSBTAP00000033996 ENSBTAP00000033996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]