SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034027 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034027
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-66
Family SPRY domain 0.0000000108
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000034027
Domain Number - Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.00034
Family SOCS box-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034027   Gene: ENSBTAG00000024539   Transcript: ENSBTAT00000034126
Sequence length 273
Comment pep:known_by_projection chromosome:UMD3.1:16:44994737:45006429:-1 gene:ENSBTAG00000024539 transcript:ENSBTAT00000034126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNND
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLIGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVA
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDL
CRRSVRLALGKGRLGEIHALPLPASLKAYLLYQ
Download sequence
Identical sequences F1MMF8
ENSBTAP00000034027 9913.ENSBTAP00000034027 XP_005216997.1.76553 XP_005216998.1.76553 ENSBTAP00000034027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]