SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034059 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034059
Domain Number 1 Region: 39-190
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 3.61e-83
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000585
Further Details:      
 
Domain Number 2 Region: 219-373
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 7.85e-20
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034059   Gene: ENSBTAG00000024552   Transcript: ENSBTAT00000034158
Sequence length 466
Comment pep:known_by_projection chromosome:UMD3.1:4:118265405:118274566:-1 gene:ENSBTAG00000024552 transcript:ENSBTAT00000034158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMLLLARCLLVLLVSSLLMCSGLACGPGRGFGKRRNPKKLTPLAYKQFIPNVAEKTLGAS
GRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG
VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKA
HIHCSVKAAHAGRARGGACQERPGCANSACEARASGGPACESLRGGGRGVAPEQTGRGAA
ARRNTFLDRDRGAKKVFYAIETREPRERLLLTAAHLLFVAPHNGSAAGAPEGAAAAAAAA
AAGGGAPGRRALFASRVRPGQHVYVVAERGGARRLLPAAVHSVTLREETAGAYAPLTAHG
TILINRVLASCYAVIEEHSWAHGAFAPYRLAHALLAALAPGRTDRGGAGDGGGGGRVPSP
APGAPGSADAPGAAGIHWYSELLYQIGTWLLDSEALHPLGMAVKSS
Download sequence
Identical sequences F1MM97
ENSBTAP00000034059 ENSBTAP00000034059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]