SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034071 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034071
Domain Number 1 Region: 68-250
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-78
Family F-box associated region, FBA 0.00000149
Further Details:      
 
Domain Number 2 Region: 6-85
Classification Level Classification E-value
Superfamily F-box domain 8.63e-16
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034071   Gene: ENSBTAG00000014777   Transcript: ENSBTAT00000034170
Sequence length 265
Comment pep:known chromosome:UMD3.1:16:42881664:42899260:-1 gene:ENSBTAG00000014777 transcript:ENSBTAT00000034170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVSINQLPENILLEVFMHVPARQLLRNCRPVCCLWRDLIDLVSLWKRKCLREGYVTED
WDQPVSDWKVFYFLCSLRRNLLRNPCAEEDMKSWKIDSNGGDQWKVESLPGAHGTGFPDS
KVKKYFVTSYDMCLKSQIIDLKAEGYWEELLDKFRPDIVVKDWFAPRADCGCTYQIRVQL
ASADYLVLASFEPPPVTIHQWNDAKWTEVSHTFSDYPPGVRHIFFQHGGKDTQFWAGWYG
PRVTNSSVVISHRVTRNPPHAMAQP
Download sequence
Identical sequences Q3SX24
ENSBTAP00000034071 NP_001029605.1.59421 NP_001029605.1.76553 XP_005217017.1.76553 XP_005217020.1.76553 XP_005217021.1.76553 XP_010811560.1.76553 XP_015330583.1.76553 XP_019832139.1.53367 XP_019832140.1.53367 XP_019832141.1.53367 XP_019832142.1.53367 XP_019832143.1.53367 XP_019832144.1.53367 XP_019832145.1.53367 XP_019832146.1.53367 ENSBTAP00000034071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]