SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034140 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034140
Domain Number 1 Region: 41-287
Classification Level Classification E-value
Superfamily L domain-like 1.7e-49
Family Ngr ectodomain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034140   Gene: ENSBTAG00000009111   Transcript: ENSBTAT00000034240
Sequence length 370
Comment pep:known chromosome:UMD3.1:16:2184534:2187560:-1 gene:ENSBTAG00000009111 transcript:ENSBTAT00000034240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLVAPLLLAWVAGATATVPVVPWHVPCPPGCACQIRPWYTPRSSYREATTVDCNDLFL
TAVPPALPAGTQTLLLQSNSIVRVDQSELGYLANLTELDLSQNSFSDPRDCDLRALPQLL
SLHLEENQLTRLEDHSFAGLASLQELYLNHNQLYRIAPRAFAGLSNLLRLHLNSNLLRAV
DNRWFEMLPSLEILMIGGNKVDAILDMNFRPLANLRSLVLAGMNLREISDYALEGLQSLE
SLSFYDNQLARVPRRALEQVPGLKFLDLNKNPPQPTGGTPSSLYLCSLSCLLFPPPWARA
EGLSSPPWGELLPTWPCPGLAGLEGRVEEGCPGTALPGSRLALTVTFCRQFCTFVEKRVT
SPQLSFAPVL
Download sequence
Identical sequences Q58DI7
ENSBTAP00000034140 NP_001070439.1.59421 NP_001070439.1.76553 ENSBTAP00000034140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]