SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034199 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034199
Domain Number 1 Region: 136-391
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-42
Family YWTD domain 0.0000216
Further Details:      
 
Domain Number 2 Region: 1014-1292
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-31
Family YWTD domain 0.000066
Further Details:      
 
Domain Number 3 Region: 12-128,384-445
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-25
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 918-1038,1284-1331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 751-788
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000995
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 6 Region: 880-920
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000115
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 713-750
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 595-631
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 9 Region: 473-517
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 673-708
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 11 Region: 435-470
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 796-840
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 13 Region: 630-670
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 14 Region: 556-592
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 515-552
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 16 Region: 1375-1410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000161
Family EGF-type module 0.012
Further Details:      
 
Domain Number 17 Region: 1518-1552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000187
Family EGF-type module 0.047
Further Details:      
 
Domain Number 18 Region: 842-874
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 19 Region: 1338-1374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000037
Family EGF-type module 0.014
Further Details:      
 
Domain Number 20 Region: 1412-1447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000466
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034199   Gene: ENSBTAG00000024632   Transcript: ENSBTAT00000034302
Sequence length 1726
Comment pep:known_by_projection chromosome:UMD3.1:2:56711720:57011911:1 gene:ENSBTAG00000024632 transcript:ENSBTAT00000034302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INPKCKSAEQSCNSSFFMCKNGRCIPSGALCDNKDDCGDGSDERNCHINECLSKKVSGCS
QDCQDLPVSYKCKCWPGFQLKDDGKTCVDIDECSLGFPCSQQCINTYGTYKCLCTDGYEI
QPANPNGCKSLSDEEPFLILADHHEIRKISTDGSNYTLLKQGLNNVIGIDFDYREEFIYW
IDSSRPNGSRINRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNGL
YPTILVSKRLKFPRDLSLDPRAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKISRPMAL
TIDYVNHRLYWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLSR
AHKTSGADRLSLINSWHAITDIQVYHSYRQPDVFKHLCTINNGGCSHLCLLAPGKSHTCA
CPTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFKCQP
GRFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNLRCNGQ
DDCGDEEDEKDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGPH
EFQCKNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVSSRFWCDGDFD
CADGSDERNCETSCSKDQFQCSNGQCISAKWKCDGHEDCKYGEDEKNCEPASPTCSSSEY
ICASGGCISASLKCNGEYDCADGSDEMDCVTECKEDQFRCRNKAHCIPIRWLCDGIHDCV
DGSDEENCDRDEGGNICRADEFLCNNSLCKLHFWVCDGEDDCGDNSDEAPDMCDKFLCPP
TRPHRCRNNRICLQPEQMCNGIDDCGDNSDEDPCGGKLTYKARPCKKDEFACSNKKCIPV
DLQCDQLDDCGDGSDEQGCRITPSEYTCEDNVNPCGDDAYCNQIKTSVFCRCKPGFQRNM
KNRQCEDLNECLVFGTCSHQCINTEGSYKCVCHQNFQERNNTCIAKGSEDQVLYIANDTD
ILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIPGREKR
QANSGLICPEFRRPRDIAVDWVAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQLSGPN
CTRLLTNMAGEPYAIAVNPKRGMMYWTVVGDHSHIEEAAMDGTLRRILVQKNLQRPTGLA
VDHFSERIYWADLELSVIGSVLYDGSDSVVSVTSKQGLLHPHRIDVFEDYIYGAGPKNGV
FRVQKFGHGSVEYLALNVDKTKGVLISHRYKQLDLPNPCSDLACEFLCLLNPSGATCACP
EGKYLINGTCNDDSLLDDSCKLTCENGGRCILNEKGDLRCHCWPSYSGERCEINHCSNYC
QNGGTCMPSVLVGRPTCSCALGFTGPNCGKTVCEDFCQNGGTCSVTAGNQPYCHCQPEHT
GDRCQYYVCHHYCVNSESCTIGDDGSVECVCPIRYEGSKCEIDKCIRCHGGHCIINKDSE
DISCNCTNGKIASSCQLCDGYCYNGGTCQLDPETNVPVCLCSTNWSGTQCERPAPKSSKS
DHISTRSIAIIVPLVLLVTLITTLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNPSYN
MYEVDHDHNDGGLLDPGFMVDPAKKKKKKYSISLPKKIKVCFRAPRKWINFSLNGTLQLQ
PTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKKIEIGIRETVA
Download sequence
Identical sequences F1MKZ6
ENSBTAP00000034199 ENSBTAP00000034199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]