SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034496 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034496
Domain Number 1 Region: 305-441
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-43
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 21-82
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000336
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034496   Gene: ENSBTAG00000024851   Transcript: ENSBTAT00000034608
Sequence length 445
Comment pep:known_by_projection chromosome:UMD3.1:8:63676509:63698768:-1 gene:ENSBTAG00000024851 transcript:ENSBTAT00000034608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSAVLKGTPGGLGPAEPEDARGWLCSEHGDRVVELFCRRCRRCVCALCPVLGSHRGHP
IGLALDEAARVQKFTQECLKHLATKKQQQVGNITQIEDAAEKLKAHAESSKTWLTGKFAE
LRLLLEEEEALAKKFIDKNTQLALQAYTEQIKSCGEQIDVMNTLSNRIWTISQETNPVQL
LQEYTATEQQIQQQMSLGELCHPVPHSFEPVKSFFKDLVEAMQSLLQTPLDVRLKESRNC
QLSGSCVQPGSLLKTSPSPERSLFLKCKTPVFFREQAPDSLRAHCRSPGGGAGRGXLGRL
GPTAALRFDALWQVLSRDCFAAGRHYWEVDVQEAGVGWWVGAAYGSLRRHGASDAARLGC
NRQSWCLKRYDLEYWAFHDCQRSRLRPRHDPDRLGVFLDYEAGVLAFYDVTGGMSHLHTF
RAAFQEPLYPALRLWEGAISISRLP
Download sequence
Identical sequences F1MMN0
ENSBTAP00000034496 ENSBTAP00000034496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]