SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034569 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034569
Domain Number 1 Region: 141-321
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.31e-47
Family C-terminal domain of adrenodoxin reductase-like 0.0000000192
Further Details:      
 
Domain Number 2 Region: 37-199
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.35e-17
Family N-terminal domain of adrenodoxin reductase-like 0.00000638
Further Details:      
 
Domain Number 3 Region: 352-487
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000318
Family N-terminal domain of adrenodoxin reductase-like 0.000000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034569   Gene: ENSBTAG00000006525   Transcript: ENSBTAT00000034683
Sequence length 488
Comment pep:known chromosome:UMD3.1:19:57164031:57175524:1 gene:ENSBTAG00000006525 transcript:ENSBTAT00000034683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRCWRWWPWSSWTRTRLPPSRSIQNFGQHFSTQEQTPQICVVGSGPAGFYTAQHLLKH
HSRAHVDIYEKQLVPFGLVRFGVLTTPRSRWNVINTFTQTARSDRCAFYGNVEVGRDVTV
QELRDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTA
VILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIK
ELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRASA
SRAWGLRFFRSPQQVLPSPDGRRQASAWQSPLEGIGEHPGSAHWGCGGPCGLVLSSIGYK
SRPIDPSVPFDPKLGVVPNMEGRVVDVPGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQ
DLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEKLDAEEVSRGQASGKPREKLLDPQ
EMLRLLGH
Download sequence
Identical sequences F1N6V9
ENSBTAP00000034569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]