SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034926 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034926
Domain Number 1 Region: 63-349
Classification Level Classification E-value
Superfamily L domain-like 1.81e-56
Family Ngr ectodomain-like 0.000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034926   Gene: ENSBTAG00000011847   Transcript: ENSBTAT00000035046
Sequence length 370
Comment pep:known chromosome:UMD3.1:8:85499333:85524670:-1 gene:ENSBTAG00000011847 transcript:ENSBTAT00000035046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVYVLLVFLTLCSAKPLFHPSYLTLKNLMLKDMEDEGDSDADNSLFPTREPINPFFPFD
LFSTCPFGCQCYSRVVHCSDLGLSSVPSNIPFDTRMVDLQNNKIKEIKENDFKGLTSLYA
LILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHDNKVKKIQKAT
FKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSIPKELPSTLLELHLDY
NKISVVELEDFKRYKDLQRLGLGNNRITDIENGSLANIPRVREIHLENNKLKKVPSGLQE
LKYLQIIFLHSNSITKVGVNDFCPTVPKMKKSLYSAISLSNNPVKYWEVQPATFRCVLSR
MSVQLGNFRK
Download sequence
Identical sequences Q3ZBN5
NP_001029481.1.59421 NP_001029481.1.76553 XP_019822135.1.53367 ENSBTAP00000034926 ENSBTAP00000034926 9913.ENSBTAP00000034926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]