SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035177 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035177
Domain Number 1 Region: 1-350
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.53e-69
Family ADP-ribosylglycohydrolase 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035177   Gene: ENSBTAG00000020928   Transcript: ENSBTAT00000035299
Sequence length 354
Comment pep:known chromosome:UMD3.1:12:90663887:90676882:-1 gene:ENSBTAG00000020928 transcript:ENSBTAT00000035299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFQAAMLLGAVGDALGFGHAARESSSLGARVQEEMGKGGGLDHLVLSPETWPVSDNTI
MHMSTAGALITDFWCLDDLYREMVRRYVDVLEKLPEQRADPATLEGCSQLKPDNYLLAWH
TPFNEKGSGFGAATKAMCVGMRYWQPERLETLVEVSVECGRMTHNHPTGFLGSLCTALFA
SYAVQGKRLEQWGRDMLRTVPLAEEYCKKTIRHLAEYQEHWFYFEAKWQFYLEERKIIED
TENEASFPDRYDAEEREKTYRKWSSEGRGGRRGHDAPMIAYDALLGAKGSWTELCRRAMF
HGGESGATGAIAGCLFGLLHGLDAVPAGLYRELEHQDELRRLGEALHRLSSQEK
Download sequence
Identical sequences Q3ZBM1
ENSBTAP00000035177 NP_001029706.1.59421 NP_001029706.1.76553 ENSBTAP00000035177 9913.ENSBTAP00000035177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]