SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035185 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035185
Domain Number 1 Region: 267-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-37
Family Laminin G-like module 0.0000000165
Further Details:      
 
Domain Number 2 Region: 474-678
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.99e-35
Family Laminin G-like module 0.000000168
Further Details:      
 
Domain Number 3 Region: 55-113
Classification Level Classification E-value
Superfamily GLA-domain 7.74e-20
Family GLA-domain 0.00071
Further Details:      
 
Domain Number 4 Region: 111-245
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000392
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035185   Gene: ENSBTAG00000019964   Transcript: ENSBTAT00000035307
Sequence length 682
Comment pep:known_by_projection chromosome:UMD3.1:12:90821803:90850163:-1 gene:ENSBTAG00000019964 transcript:ENSBTAT00000035307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPRPAMPPGPAAALGTALLLLLSALSPLLPPAREAVMLRAREAAQFLRPRQRRAYQVFE
EAKQGHLERECVEELCSREEAREVFENDPETEYFYPRYLECINKHGSPYQKNPAFVTCVQ
KLPDQCSPDPCNKKGTHVCQDLMGNFYCQCRDGWAGRLCDRDVNECSQENGGCSQICYNQ
PGSFQCACHGGYMLSPDSRTCLDVDECVDAGACGAARCQNLPGSYSCVCDEGYVFSSQEK
GCQDTDECVEGRCEQVCANSPGSYTCHCDGRGGLKLSQDMSTCEDILPCVPFNVAKSVNS
LYLGRMFSAMPVIKLLFKRLQPTRLVAEFDFRTFDPEGILFFAGGHRDSTWIVLGLRAGR
LELQLRYQGVGRVTSSGPVINHGSWQTISVEELERNLVIKVNKDAVMKIAVAGDLFQLDR
GLYHLNLTVGGIPFQEKDLVHPMNPRLDGCLKSWHWLDGEDTAVQETVKANVKMQCFSVT
ERGSFFPGSGFAFFHLDYARTSPAGGTKTTWAVEAVARVRPAADTGVLLALVGDHQAVAL
SVALVDYHSTKKLKKQLVVLAVEGVTLVLMEIKVCDGQEHVVTISVNKDRATLEVDGTQG
QSEVSPAGLREQLAILGRHLEGSVLTFIGGLPDVPVTSAPVTAFYRGCMTLEVNRKALDL
DEAAYKHSDITSHSCPPVEPAA
Download sequence
Identical sequences F1MZ40
ENSBTAP00000035185 ENSBTAP00000035185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]