SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035220 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035220
Domain Number 1 Region: 30-254
Classification Level Classification E-value
Superfamily L domain-like 2.92e-41
Family Ngr ectodomain-like 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000035220
Domain Number - Region: 317-392
Classification Level Classification E-value
Superfamily FAS1 domain 0.0053
Family FAS1 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035220   Gene: ENSBTAG00000025213   Transcript: ENSBTAT00000035344
Sequence length 440
Comment pep:known chromosome:UMD3.1:19:19044190:19046816:1 gene:ENSBTAG00000025213 transcript:ENSBTAT00000035344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYQILKMSPSLFILLFLTPGILCICPLQCICTERHRHVDCSGRNLTTLPSGLQENIIHL
NLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLEKSDTA
YQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHTVDLSNNSLT
QILPGTLINLTNLTHLYLHNNKFTFIPDQAFDQLFQLQEITLYNNRWSCDHHQNITYLLK
WMMETKAHVIGTPCSSQISSLKEHSIYPTPSGFTSSLFTVSGMQTVDTINSLSTVTQSKV
TKIPKQYRTKETTFGATLSKDTTLTSTDKAFVPYPEDTSTETINSREAAAATLTIHLQDG
MVTNTSLTSSTKSSPTPMTLSITSGMPNDFSEMPQQSTTLNLRREETTTDGKTRLPSVAS
AWKVNASFLLMLNAVVMLAV
Download sequence
Identical sequences Q0IIH3
9913.ENSBTAP00000035220 ENSBTAP00000035220 ENSBTAP00000035220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]