SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035459 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035459
Domain Number 1 Region: 248-571
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.16e-60
Family Glutamine synthetase catalytic domain 0.00072
Further Details:      
 
Domain Number 2 Region: 138-244
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.44e-19
Family Glutamine synthetase, N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035459   Gene: ENSBTAG00000010051   Transcript: ENSBTAT00000035588
Sequence length 574
Comment pep:known_by_projection chromosome:UMD3.1:2:238093:305169:1 gene:ENSBTAG00000010051 transcript:ENSBTAT00000035588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDEGDLLKEDTRDEGNETKASSVSKLMRTREKVTKLHIFSTEVGEMDISNSKEKNRNLR
VCHKLGDTDKPVMAPGSPESHLTPDDKDSKDQTVAIKPLSLPTLINDPGDEFHPNSSDTD
NTRDNTQVPTAPQLSSRMKHIKQEMAKNHLQFVRFEATDLHGVSRSKSIPAQFFQEKVIH
GVYMPRGYLELIPNPKDNEVDHIRATCFNSDIVLMPELSTFRVLPWAKRTARVICDTFTV
TGEPLLTSPRHIAKRQLSQLQDAGFSLLSAFIYDFCIFGVPEIINSKTISLPASALLNNH
DQLFIQELVDGLYHTGANVESFSSSTRPGQMEICFLPEFGISSADNAFTLRMAVKEVARK
YNYITSFFIETGFCNSGILSHSLWDVDEKKNMFCSNSGIEQLTIPGKKWLAGLLKHSAAL
SCLMAPAVSCRKRYSKESKDLKESVPTTWGYNDNSCAFNIKCHGEKGTRIENKLGSATAN
PYLVLAATVAAGLDGLYSDDGVLSGPENSTDLHQSKPSEIPLKLEHALMALEEDQCLRQA
LGETFIRYFVAMKKYELENEETDAERNKFLEYFI
Download sequence
Identical sequences F1MZE0
ENSBTAP00000035459 ENSBTAP00000035459 NP_001178065.1.59421 NP_001178065.1.76553 XP_019840354.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]