SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035484 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035484
Domain Number 1 Region: 2167-2301
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-19
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 570-699
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-18
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 3 Region: 1152-1290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 989-1057
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.02e-17
Family TB module/8-cys domain 0.00084
Further Details:      
 
Domain Number 5 Region: 1066-1197
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 2089-2160
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.27e-17
Family TB module/8-cys domain 0.00011
Further Details:      
 
Domain Number 7 Region: 753-889
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.96e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 1565-1638
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.28e-16
Family TB module/8-cys domain 0.0000614
Further Details:      
 
Domain Number 9 Region: 1887-2012
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 10 Region: 361-431
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.45e-16
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 11 Region: 2374-2444
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.36e-16
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 12 Region: 886-970
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000249
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 13 Region: 691-763
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000301
Family TB module/8-cys domain 0.001
Further Details:      
 
Domain Number 14 Region: 1725-1792
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000785
Family TB module/8-cys domain 0.00073
Further Details:      
 
Domain Number 15 Region: 215-300
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000863
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 16 Region: 1448-1575
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000942
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 17 Region: 1357-1489
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 18 Region: 1644-1699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000249
Family EGF-type module 0.00058
Further Details:      
 
Domain Number 19 Region: 2527-2658
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000408
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 20 Region: 260-370
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000612
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 21 Region: 2486-2534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000192
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 22 Region: 2625-2733
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000022
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 23 Region: 1318-1375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000776
Family EGF-type module 0.011
Further Details:      
 
Domain Number 24 Region: 530-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000174
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 25 Region: 2446-2498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000194
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 26 Region: 2012-2063
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000647
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 27 Region: 1758-1887
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000706
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 28 Region: 2049-2104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 29 Region: 2329-2378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000188
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 30 Region: 1279-1320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000245
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 31 Region: 495-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000105
Family EGF-type module 0.019
Further Details:      
 
Domain Number 32 Region: 2288-2326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000089
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035484   Gene: ENSBTAG00000000595   Transcript: ENSBTAT00000035613
Sequence length 2896
Comment pep:known_by_projection chromosome:UMD3.1:7:18006365:18076590:-1 gene:ENSBTAG00000000595 transcript:ENSBTAT00000035613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGRRRRLGENTEWQLWAGNSAGSASRFRDPAPGPPAPRRAGPPTPSPARPLVSPASTRAG
WQGVQGRWDGAVQPAGLGSVRRRGSPGFLQGPNVCGSRFHAYCCPGWRTLPGGNQCVVPI
CRHACGQGFCSRPNLCACADGKLAPSCGVSRGSGCSVSCMNGGSCRGESCLCQRGYTGTV
CGQPVCDHGCHNGGRCIGPNHCACVYGFMGPQCERDYRTGPCFGRVGPEGCQHQLTGLIC
TKALCCATVGRAWGFPCELCPAQPHPCRRGFIPNINTGACQDVDECQAVPGLCQGGSCVN
TVGSFECRCPTGHRLSENSAKCEDVDECLSVPGLCSGGDCTNTVGSYVCTCPHGYASSLD
GTRCLDHRAGTCFSVLIAGRCTGDLSGHYTHRQCCCDKGRCWAAGPAPELCPPRGSDEFQ
RLCAPGLPLLPSYPGPFPSLPGFGSSGGVGPGPGLARHSPHGSSGRRVPSLGLGDGSIGE
DLGGTATLNQTIDICRHFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECASSP
CHHGDCINTPGSYRCRCHEGFQATLTKQACLDIDECIASSGLCHHGRCVNTEGSFQCVCN
AGFELSTDSKNCVDHNECATTTMCANGVCLNEDGSFTCLCKPGFLLAPGGRHCVDIDECQ
TPGICMNGHCTNTEGSFHCRCLGGLAVAADGRVCVDTHVRSTCYGTLDQGSCARPFPGAV
TKSECCCASPAHGFGEPCQLCPPKNSAEFQALCSSGLGITTDGRDINECALDPDVCANGM
CENLRGSYRCICNLGYEAVADGRECTDVDECALNSLLCDNGRCRNSPGSYSCSCPQGFSF
RPDTETCEDIDECLSNPCVNGVCRNLAGSYACECAPGSRLGPSGTMCLDSTKGTCWLKIQ
DGRCEANLHGATLRSECCATLGTAWGSPCERCDMDRACARGFARVKGLSCEDVNECEVFP
GVCPNGRCINTAGSFRCECPEGLILDTSGRLCIDMRLELCFLRWEEDECGAALLGKYRMD
VCCCTVGAAWGTTCEACPEPESPAFTSLCPRGLGFASRDFLSGRPFYKDVNECKAFPGLC
AHGTCRNTVGSFRCSCAGGFALDTQERNCTDIDECRISPDLCGQGTCVNTPGSFECECLR
GYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYECQCPPGHALAAEGTACEDVDEC
SLSDGLCPHGQCVNVIGAFQCSCYAGFQSTPDRQGCVDVDECRTRNGGCHVHCVNTKGSY
QCECGPGYSLMPDGRACEDVDECEQNPDICDGGQCTNMPGGHRCLCYDGFVATLDMRMCV
DVDECDLNPHICLHGVCENTRGSFVCHCQLGYIVRKGAMGCSDVDECQLGGHSCDSHASC
LNTPGSFSCSCQPGWVGDGFKCRDLDECASKEHGCSPRADCLNAPGSYRCACRLGFSGDG
FSCEDRDECAENVALCENGQCLNVPGGYRCECEMGFSPTKDQHACQDVDECVLRNICVFG
SCENLPGMFRCICDEGYELDRGGGNCTDVNECADPVNCINGLCVNTPGSYLCNCPQDFEL
NPSGVGCVDTRVGNCFLDTQHRGDGGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPLA
NTTEYRTLCPGGEGFRPNSITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPPGYHLN
EDTRICEDIDECSAHSGICGPGTCYNTLGNYTCVCPVEYLQVNGGNNCMDMRKSVCFRHY
NSTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPASLDYQILCGNQVPGFVIDIHTG
KPLDIDECGEIPAICASGVCINQIGSFRCECPAGFSYNSLLLVCEDVDECTSGENPCQQN
ADCVNIAGSYRCKCAQGYKLSPGGACVGRNECREIPNACSHGDCMDTVDSYMCLCHRGFR
ASADQTLCMDVDECDRQPCGNGTCKNIVGSYNCLCFPGFVAAHNGDCVDMDECTTMVGQV
CRFGQCLNTAGSFHCLCKDGFELTSDGKNCIDTNECLSLPGTCLPGTCQNLEGSFRCICP
PGFQVQSDHCVDIDECSEEPNLCLFGTCTNSAGSFDCLCPPDFVLSDNGHRCFDTRQSFC
FTHFEAGKCSVPKAFNTTKARCCCSQRPGEGWNDPCELCPQEGSVAFQELCPFGHGAVPG
PDDSREDVNECAETPGVCTNGLCVNTDGSFRCECPFGYSLDFTGVSCVDTDECSIGHPCG
GGTCTNVIGGFECACADGFEPGPMMTCEDIDECSLNPLLCAFRCHNTEGSYVCTCPVGYA
LREDGAMCRDVDECADGEQDCHARGMLCKNLIGTFACICPPGMRPQSGSGEGCTDDDECR
AQPSPCANGHCINTVGSFHCDCDEGYQPSPSLTKCQDIRQGPCFSEVLQATCQAQSSRGE
AVTRAECCCGGGRGWGPGCEPCPLPGTSAHRKLCPHGSGYTADGRDVDECRVLPHLCPHG
ECINSLGSFRCHCQAGYAPDTTATACLDVDECSQAPTPCPFLCKNTEGSFLCACPRGYLL
EENGRICRDLDECSSRQHNCQFFCVNTIGAFTCRCPPGFTQRHQACFDNDECLAQPGPCG
TRGRCHNAPGSFSCECYQGFTLDSSGHGCKDVDECNGPHRCKHGCQNELGGYRCSCPQGF
TPHSQWSQCVDENECVLSPSACGSASCHNTLGGFRCVCPSGFDFDQAVRGCQDVDECAAR
SGPCSYSCANTPGGFLCGCPRGYFRAGQGHCVSGLGFSPGSQDAPDEGEPLSPEACYECK
INGQPSRDRPRRSARRDHQPPGLSPQASLASLDTEAPLTLGLNLSCLGQAQHILELRPAL
ESLGGRVRYVIARGNERGFFRMHHLHGLSSLQLGHRKPGPGTYQLEVVSVGEPWGTQPEG
RPGGQALRLKVQLQLL
Download sequence
Identical sequences F1MZD0
ENSBTAP00000035484 ENSBTAP00000035484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]