SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035516 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035516
Domain Number 1 Region: 107-291
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 3.79e-51
Family Isochorismatase-like hydrolases 0.0000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035516   Gene: ENSBTAG00000000341   Transcript: ENSBTAT00000035645
Sequence length 298
Comment pep:known chromosome:UMD3.1:7:26174298:26197424:-1 gene:ENSBTAG00000000341 transcript:ENSBTAT00000035645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAEPAVPALPGGGGAGAGAPSGTVPVLFCFSVFARPAAVPHGAGYELLIQKFLSLYGD
QIDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCC
DMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLVL
PKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSR
SMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences A6QLY4
NP_001094683.1.59421 NP_001094683.1.76553 XP_019820150.1.53367 9913.ENSBTAP00000035516 ENSBTAP00000035516 ENSBTAP00000035516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]