SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035640 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000035640
Domain Number - Region: 61-94
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00153
Family Di-heme elbow motif 0.052
Further Details:      
 
Domain Number - Region: 2-66
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0659
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035640   Gene: ENSBTAG00000003469   Transcript: ENSBTAT00000035771
Sequence length 112
Comment pep:known chromosome:UMD3.1:10:77359722:77378295:1 gene:ENSBTAG00000003469 transcript:ENSBTAT00000035771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVDCVEKEYPNRGNICLESGSFLLNFTGCAVCNKRDFMLITNKSLKEEDGEEIVTYDHL
CKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF
Download sequence
Identical sequences A0A140T8B3
ENSBTAP00000035640 ENSBTAP00000035640 NP_001040046.1.59421 NP_001040046.1.76553 9913.ENSBTAP00000035640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]