SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035935 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035935
Domain Number 1 Region: 721-895
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-41
Family MAM domain 0.00031
Further Details:      
 
Domain Number 2 Region: 417-517
Classification Level Classification E-value
Superfamily Immunoglobulin 2.25e-17
Family I set domains 0.034
Further Details:      
 
Domain Number 3 Region: 217-305
Classification Level Classification E-value
Superfamily Immunoglobulin 6.29e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 24-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000154
Family I set domains 0.04
Further Details:      
 
Domain Number 5 Region: 322-403
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000321
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 512-603
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000333
Family I set domains 0.059
Further Details:      
 
Domain Number 7 Region: 128-195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000855
Family I set domains 0.035
Further Details:      
 
Domain Number 8 Region: 628-705
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000356
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035935   Gene: ENSBTAG00000005697   Transcript: ENSBTAT00000036071
Sequence length 932
Comment pep:known_by_projection chromosome:UMD3.1:10:39914871:40445335:-1 gene:ENSBTAG00000005697 transcript:ENSBTAT00000036071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPTVRIVHSGLACNIEEERYSERVYTIREGETLELTCLVTGHPRPQIRWTKTAGSASDR
FQDSSVFNETLRITNIQRHQGGRYYCKAENGLGSPAIKSIRVDVYYLDDPVVTVHQSIGE
AKEQFYYERTVFLRCVANSNPPVRYSWRRGQEVLLQGSDKGVEIYEPFFTQGETKILKLK
NLRPQDYANYSCIASVRNVCNIPDKMVSFRLSNKTASPSIKLLVDDPIVVNPGEAITLVC
VTTGGEPVPSLTWVRSFGTLPEKTVLNGGTLTIPAITSEDAGTYSCIANNNVGNPAKKST
NVIVRALKKGRFWITPDPYHKDDNIQIGREVKISCQVEAVPSEELTFSWFKNGRPLRSSE
RMVITQTDPDVSPGTTNLDIIDLKFTDFGTYTCVASLKGGGISDISIDVNISSSTVPPNL
TVPQEKSPLVTREGDTIELQCQVTGKPKPIILWSRADKEVAMPDGNMQMESYDGTLRIVN
VSREMSGMYRCQTSQYNGFNVKPREALVQLIVQYPPAVEPAFLEIRQGQDRSVTMSCRVL
RAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYPVKSLSSENYGVYNCSIINEAGAGRCSF
LVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQMNPDAVDRIVAYRLGIRQAGQQRWW
EQEIKINGNIQKGELITYNLTELIKPEAYEVRLTPLTKFGEGDSTIRVIKYSAPVNPHLR
EFHCGFEDGNICLFTQDDTDNFDWTKQSTATRNTKYTPNTGPNADRSGSKEGFYMYIETS
RPRLEGEKARLLSPVFSIAPKNPYGPTNTAYCFSFFYHMYGQHIGVLNVYLRLKGQTTIE
NPLWSSSGNKGQRWNEAHVNIYPITSFQLIFEGIRGPGIEGDIAIDDVSIAEGECAKQDL
TTKNSVDGAVGILVHIWLFPVIVLISILSPRR
Download sequence
Identical sequences F1MX14
ENSBTAP00000035935 ENSBTAP00000035935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]