SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035936 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035936
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily EF-hand 8.43e-44
Family Calmodulin-like 0.0000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035936   Gene: ENSBTAG00000012439   Transcript: ENSBTAT00000036072
Sequence length 204
Comment pep:known chromosome:UMD3.1:23:15910249:15921069:-1 gene:ENSBTAG00000012439 transcript:ENSBTAT00000036072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQFSWEEVEENGAVGAADAAQLQEWYKKFLEECPSGTLFMHEFKRFFKVPDNEEATQY
VEAMFRAFDTNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRQELLDI
VESIYKLKKACSVEVEAEQQGKLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWV
MKMLQMDLNPSSWISQQRRKSAMF
Download sequence
Identical sequences F1MWV0
9913.ENSBTAP00000035936 ENSBTAP00000035936 ENSBTAP00000016509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]