SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035962 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035962
Domain Number 1 Region: 410-442,480-584,698-813
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.87e-51
Family Phosphate binding protein-like 0.0000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035962   Gene: ENSBTAG00000025597   Transcript: ENSBTAT00000036098
Sequence length 1045
Comment pep:known_by_projection chromosome:UMD3.1:7:45130771:45141868:1 gene:ENSBTAG00000025597 transcript:ENSBTAT00000036098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFVPALWLGLALVLGPGPAGGHPHPCGVLARLGGSVRLGVLLPRAPAARARARAALARA
SLGPRLPHNLSLELVAASPPARDPASLARGLCQCWRHRGVAALIAFPHQNPRLPPPLLDL
GVHSLFLFPPIDWNLARSRNCTPAVGPNPFHLQLDWASPLETLLDVLVSVLQAHTWEDIG
LVLCCVRDPGSLVVLWTSRAGRAPKLVLDLSRQELGDAGLSARLALLGAPAGGKAPVPAA
VLLGCDVAHSQQVLQAAPPGPRWLLGTPLPAEALPTEGLPPGVLALGEVARPPLEVAIQD
VVELVARALDSAARVQPEHTLLPATVNCSDLPPPEPESSGRLLTRFLANTSFWGRTGPVW
VTNSSQVHISRRFRLWSLRRDLRGAPAWATLGRWQDGQLESEAWGAAERPPPLPGAQERP
KLRVVTLVEHPFVFARQPDEDGRCPAGQLCLAPGINDSAALDALFAALADGSAPRALRRC
CYGYCIDLLERLAEDAPFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSIN
SARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSMWLGVFAALHLTALFLTLY
EWRSPFGLTPRGRNRDTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRLLMNLWAIFCLL
VLSSYTANLAAVMVGDKTFEELSGIHDPKLFFNXQGFRFGTVWESSAEAYIKKSFPEMYS
HVRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCRLLTVGKPFVIEGYGI
GLPRNSPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMGVYHFSGLF
VLLCLGLGSALLSSLGEHVFYHLALPRIRRGNKLQYWLHTSQRIHRALNTEPPEGQEEAE
SRGLEEPQNNTQAAPAGPGGWTRIRRAAVRERRVRFLLEHTVVSASPPDAAVPDADPAAP
PEAPVCSNGPPAELRSGAPLPRELEELEQRIAGAQERLRQALLRRRALLAQLGDSTQGTP
KRLDPRAASPKESPPHLDEEPGGDE
Download sequence
Identical sequences F1MWI8
ENSBTAP00000035962 ENSBTAP00000035962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]