SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036054 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036054
Domain Number 1 Region: 128-308
Classification Level Classification E-value
Superfamily MIR domain 8.76e-48
Family MIR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 997-1088
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-18
Family SPRY domain 0.045
Further Details:      
 
Domain Number 3 Region: 577-724
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000131
Family SPRY domain 0.065
Further Details:      
 
Domain Number 4 Region: 3932-4010
Classification Level Classification E-value
Superfamily EF-hand 0.00000000941
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 5 Region: 1345-1473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000178
Family SPRY domain 0.019
Further Details:      
 
Domain Number 6 Region: 353-467
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000118
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 7 Region: 2076-2141
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000785
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Domain Number 8 Region: 12-93
Classification Level Classification E-value
Superfamily MIR domain 0.0000123
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036054   Gene: ENSBTAG00000025642   Transcript: ENSBTAT00000036191
Sequence length 4903
Comment pep:known_by_projection chromosome:UMD3.1:10:28789149:29100901:-1 gene:ENSBTAG00000025642 transcript:ENSBTAT00000036191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAAQGGGHRTLLYGHAILLRHSFSGMYLTCLTTSRSQTDKLAFDVGLREHATGEACWWTI
HPASKQRSEGEKVRIGDDLILVSVSSERYLHLSISNGNIQVDASFMQTLWNVHPTCSGSS
IEEGYLLGGHVVRLFHGHDECLTIPSTDQNDSQHRRIYYEAGGAGTRARSLWRVEPLRIS
WSGSNIRWGQAFRLRHLTTGHYLALTEDQGLILQDRGKSDTKSTAFSFRASKEIKEKLDS
SHKRDIEGMGVPEIKYGDSVCFVQHIASGLWVTYKAQDAKTSRLGPLKRKVILHQEGHMD
DGLTLQRCQREESQAARIIRNTTALFSQFVSGIKKFSGSYMPNNGKTAPVTLPIEEVLQT
LHDLIAYFQPPEEGMQHEGKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLNIYNSIAHFA
GIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSNNLDWLISKLDRLESSSGILEVL
HCILIESPEALNLIAEGHIKSIISLLDKHGRNHKVLDVLCSLCLCDGVAVRANQNLICDN
LLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKWYFELIIDQVDPFLTAEPTHLRV
GWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRIPRAVASINQHLLKSDDVV
SCCLDLGAPSISFRINGQPVQGMFENFNTDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLP
PSGYAPCYEALLPKEKMRLEPVKEYKRDAEGIRDLLGTTQFLSQASFIPCPIDTSQVVLP
PHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSKLPETEKNYNLQM
STETLKTLLALGCHIAHVNPAAEDDLKKVKLPKNYMMSNGYKPAPLDLSDVKLLPPQEVL
VDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYSLLDERTKKSNRDSLREAVR
TFVGYGYNIEPSDQELADPAVEKVSIDKIRFFRVERSYAVRSGKWYFEFEVVTGGDMRVG
WARPGCRPDIELGADDQAFVFEGSRGQRWHQGSGYFGRTWQPGDVVGCMINLDDASMIFT
LNGELLITNKGSELAFADYEIDNGFVPICSLGLSQIGRMNLGMDASTFKFYTMCGLQEGF
EPFAVNMNRDVAMWFSKRLPTFVNVPKDHPQIEVVRIDGTMDTPPCLKVTHKTFGTQNSS
ATMIYCRLSMPVECHSSFSHSPCMDSDAFQKRAEELKHGLSSPQETDNISMASLKWGKEK
QLKGTPVEGERGAVKNSGQKAMLPNFFLPSPDQKKKKKNCFFIKKMMKQSLKQTVPSSPQ
QPEEPEETHSPQLGSLTPSVVSPQQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLN
KNCTVTVTLGDERGRVHESVKRSNCYMVWGGDIVATSQRASRSNVDLEIGCLVDLAMGML
SFSANGRELGTCYQVEPNTKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFKSEEKNP
VPQCPPRLDVQTIQPVLWSRMPSSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRC
VDILELCEQEDLMRFHYHTLRLYSALCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLL
RSGFYDLLISIHLASAKERKLMMKNEYIIPITSTTRKIRLYPDESKRHGLPGVGPRTCLK
PGFRFSTPCFITTNEEHQKQSPEIPLELLKTKALGMLTEAVQCSGAHIRDPVGGSVEFQF
VPVLKLIGTLLIMGVFDDDDVRQILLLIDPSVFGEHSGETEEGAEKEEVTQVEEKAVEAG
EKASREAPIKGLLQTRLPESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQENQK
FRYNELMQALNMSAALTARKTREFRSPPQEQINMLLNFQLGENCPCPEEIREELYDFHED
LLLHCGVPLEEEEEEEEDSSWTGKFCALVQRIKGPPKPEKEQPTEEEERCPTTLKELISQ
TMIRWAQEDQIQDAELVRMMFNLLRRQYDSIGELLQALRKTYTISQASVSDTISLLAALG
QIRCLLSVRMGKEEELLMINGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGAEKL
QIAFPKMVASCCRFLCYFCRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAAS
SVMDNNELALGLEEPDLEKVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFA
VFVNSESVEENASVVVKLLIRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQG
YKREVHHFCSTEDDDDEEEIVHMGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRS
ILRSLVPTEDLVGIISIPLKLPSLNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQ
TFLLHLLEVGFLPDLRASASLDTVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHY
TSLIDSTLQTIYRLSKGRSLTKAQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNE
YCKMPLKLLTNHYEQCWKYYCLPSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKRYDPDL
FRMALPCLSAIAGALPPDYLDTRISATLEKQVSVDADGNFDPKPINTVNFSLPEKLEYIV
TKYAEHSHDRWACDKSQNGWKYGISLDENVKTHPLIRPFKTLTEKEKDIYRWPARESLKT
MLAVGWTVERTKEGEALVQQRENEKLRSVSQASQVRPSRPKGNSYSPAPLDLSNVVLSRE
LQGMVEVVAENYHNIWAKKKKLELESKGGGSHPLLVPYDTLTAKEKFRDREKAQDLFKFL
QVNGIVVSRGMKDMELDASSMEKRFAYKFLKKVLKYVDSAQEFIAHLEAIVSSGKNEKSP
HDQEIKFFAKVLLPLVDQYFINHRLYFLSSPLKPLSSSGYASHKEKEMVASLFCKLAALV
RHRISLFGSDSTTMVSCLHILAQTLDTRTVMKSGSELVKAGLRAFFENAAEDLEKTLENL
KLGKFTHSRTQIKGVSQNINYTTVALLPILTSIFEHVAQHQFGVDLLLGDVQLSCYHILC
SLYSLGTGKNIYVERQRPALGECLASLAAAIPVAFLEPTLNRYNPLSVFNTKTPRERSIL
GMPDTVEEMCPDIPQLEGLMKEINDLAESGARYTEMPHVIEVILPMLCNYLSYWWERGPE
HLPPSAGPWCTKVTSEHLSVILGNILKIINNNLGIDEASWMKRIADTVYAQPIISKARPD
LLRSHFIPTLEKLKKKAIKTVQEEEQLRADSKGDTQEAELLILDEFAVLCRDLYAFYPML
IRYVDNNRSNWLKSPDADSDQLFRMVAEIFILWCKSHNFKREEQNFVIQNEINNLAFLTG
DSKSKMSKSGGQDQERKKTKRRGDFYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAK
SRYSYKDTDEEVKEHLRNNLHLQEKSDDPAVKWQLNLYKDVLKSEEPSNPEKTVERVQRI
SAAVFHLEQVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQR
FWIETEEYSFEEKLVQDLAKSPKVEEEEEEEVEKQPDPLHQIILHFSRNALTERSKLEDD
PLYTSYASMMAKSCQSGEDEDEDEDKEKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMI
SASKGEMSPMVVETLKLGIAILNGGNAGVQQKMLDYLKEKKDAGFFQSLSGLMQSCRSVL
DLNAFERQNKAEGLGMVTEEGTLIVRERGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNF
LRTQMGNTTTVNVIISTVDYLLRLQESISDFYWYYSGKDIIDESGQHNFSKALAVTKQIF
NSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLLQD
MVVMLLSLLEGNVVNGTIGKQMVDTLVESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDP
DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYIDFVDRFHEPAKDIGFN
VAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSR
TQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPDE
EEEEGGDSSYVLEVEGEEEEEEKSFECASAFAMACGSVKRNVANFLKRATLKNLRKQYRK
VKKMTFKELVKVFFSFFWTLFMGLFHLLFTIVGGIIQVLWSTVFGGGLIEGAKNIRVTKI
LGDMPDPTQFGIHDDAMEAERAEVPEPGIATELVHFVKGQKGDADIMSDLFGLHPKKEGG
LKHGPEVGLGDLSEIIGKDETPTLESTVRKKRKAQVSTQAAEMKAAHEAERKIESEKADM
EDGEKEDTAKEEEQAEALWADVTKRKKRRCGQKVEKPEAFMANFFKGLEIYQTKLLHYLA
RNFYNLRFLALFVAFAINFILLFYKVTEEPLEEETEDVANLWNSFNDEEEEEAVVFFVLQ
ESTGYMAPTLRALAIIHTVISLVCVVGYYCLKVPLVVFKREKEIARKLEFDGLYITEQPS
EDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKYGDLYGAERIAELLGLDKNALDFSPV
EETKAEAASLVSWLSSIDMKYHVWKLGVVFTDNSFLYLAWYTTMSVLGHYNNFFFAAHLL
DIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDDDEPDM
KCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIVILLAIIQG
LIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMY
LINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences F1MHA5
ENSBTAP00000036054 ENSBTAP00000036054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]