SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036514 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036514
Domain Number 1 Region: 7-318
Classification Level Classification E-value
Superfamily Subtilisin-like 6.55e-89
Family Subtilases 0.00000000136
Further Details:      
 
Domain Number 2 Region: 317-467
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-43
Family Proprotein convertase P-domain 0.0000779
Further Details:      
 
Domain Number 3 Region: 1289-1451
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.27e-31
Family Growth factor receptor domain 0.00053
Further Details:      
 
Domain Number 4 Region: 649-814
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.83e-26
Family Growth factor receptor domain 0.0012
Further Details:      
 
Domain Number 5 Region: 500-656
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.23e-24
Family Growth factor receptor domain 0.00024
Further Details:      
 
Domain Number 6 Region: 1193-1324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.49e-24
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1439-1595
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.32e-24
Family Growth factor receptor domain 0.00031
Further Details:      
 
Domain Number 8 Region: 1057-1207
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.03e-22
Family Growth factor receptor domain 0.0018
Further Details:      
 
Domain Number 9 Region: 787-913
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.75e-17
Family Growth factor receptor domain 0.0014
Further Details:      
 
Domain Number 10 Region: 956-1014,1060-1117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000267
Family Growth factor receptor domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036514   Gene: ENSBTAG00000008101   Transcript: ENSBTAT00000036658
Sequence length 1730
Comment pep:known_by_projection chromosome:UMD3.1:8:52292117:52712391:1 gene:ENSBTAG00000008101 transcript:ENSBTAT00000036658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGN
DLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAK
SVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGR
SKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQ
RCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGF
KVSHLYGFGLMDAEAMVMEAEKWTTVPQQHVCVESTDRQIKTIRPNSAVRSIYKASGCSD
NPNHHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANRLFDHSMEGFKNWEFMT
IHCWGERAAGDWILEVYDTPSQLRNFKTPGKLKEWSLVLYGTSVQPYSPTNEFPKVERVR
YSRVEDPTDDYGTEDYAGGPCDPECSEVGCDGPGPDHCNDCLHYYYKLKNNTRICVSSCP
PGHYHADKKRCRKCAPNCDSCFGSHGDQCLSCKYGYFLNEETNSCVTHCPDGSYQDTKKS
LCRKCSENCKTCTESDNCTECREGLSISLHIANHCLILSTSGWFHYAVSKKCDVCRQPLD
NFSGAGADGCINCTGGYFMEERRCVQSCSISYYFDHSSENGYKSCKKCDASCLTCNGPGI
KNCTSCPSGYLLDLGMCQMGAICKDGEYVDEHGHCQICEASCIQCRGPTQEDCTGCPVTR
VLDDGRCVLNCSLGKFEFRNQCHPCHFTCQECQGDEPSNCTSCGVDKHGQERFLYWGECR
ESCPPGYYPEEGHTCQPCPDNCELCHSTHVCTRCVRGYFMVPSNHTCQKLECGQGEIQDP
DYEECVSCEEGCLNKMYTRLVSPCVFLCQMVYTYMQTHTYVSNPLNPMTGATLIYCTPKF
HNCFSSDYSQCLSCCFFFFFLSKYCVLSCKIFFFTHDVVKGFSSCGLMCRHLKGAANSAC
SLESSTFLLQPQPCFLRVRSPVESLSINSKGSLEPSGNKCAICHNSTSTIYKRTPGTYLL
AQTCVPSCPQGTWPSVRSGSCENCTEDCASCSEVNLCQKCQTRPDRPLFLHQGRCSTRCP
EGFYADNDTCEHCSSSCRTCEGNATNCQSCERGLVLDQGVCRETCPERHVAMEGVCKRCP
EMCQDCIHEKTCKECMPEFFLHKDACHQSCPSHFYADGRHCVSCHEDCLECSGPWADDCD
LCAEASLVLYDGQCLDECPEGTYLEKETKVCKDCQKSCRTCSSSGACTTCQEGLRVNNHG
GCVPHTECAAREYWDKEAQACEACHAKCLHCTGPSEFQCQTCLRDSLLLNTTCMQDCPEG
YYADEDSHRCAPCHSSCRTCEGRHSMQCLSCQPGWFQLGQECLTQCREGYYAENSTGQCR
RCHRSCKACQGPQPTDCLSCDPFFFLLRSKGQCHRTCPEHYYMEPSTQTCERCHPTCDKC
KGKGALNCLSCVWSYHLAGGLCTSDCLVGEYRVGEGEKFNCEKCHESCIECKGPGTRNCT
VCPANLVLHMDDSRCLRCCSASDPTDAQECCDCHDTEDECILRASTVEPAGERSKTALLI
TSSIMLVLLLGAAVIVWRKSRSRAKSTGKAGYAKLAEPSVSYSSYKSSHRESFEEDQVIE
YRDRDYDEDDDDDIVYMGQDGTVYRKFKYGLLDDDNEDDLEYDDESYSYQ
Download sequence
Identical sequences F1N7K2
ENSBTAP00000036514 ENSBTAP00000036514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]