SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036727 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036727
Domain Number 1 Region: 52-454
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.09e-90
Family L-arabinose binding protein-like 0.00052
Further Details:      
 
Domain Number 2 Region: 878-1061
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.98e-61
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000498
Further Details:      
 
Domain Number 3 Region: 563-853
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.03e-50
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036727   Gene: ENSBTAG00000026003   Transcript: ENSBTAT00000036876
Sequence length 1103
Comment pep:known chromosome:UMD3.1:X:62214456:62364957:-1 gene:ENSBTAG00000026003 transcript:ENSBTAT00000036876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLAPWPFSHLMLWFVTLGRQRGQHGLASFKLLWCLWLLVLMSLPLQVWAPPYKIGVVGP
WTCDPLFSKALPEIAAQLATERINKDPALDLGHSLEYVIFNEDCQASRALSSFISHHQMA
SGFIGPANPGYCEAASLLGNSWDKGIFSWACVNYELDSKNSHPTFSRTLPSPIRVLLTVM
KYFQWAHAGVISSDEDIWVHTAYRVASALRSRGLPVGVVLTTGQDSQSIQKALQQIRQAD
RIRIIIMCMHSTLIGGETQTHLLEWAHDLQMTDGTYVFVPYDTLLYSLPYKHTPYKVLRN
NPKLREAYDAVLTITVESQEKTFYQAFEEAAARGEIPEKLESDQVSPLFGTIYNSIYFIA
QAMNNAMKENGWASAASLVQHSRNMQFYGFNQLIRTDANGNGISEYVILDTNWKEWELHS
TYTVDMETELLRFGETPIHFPGGRPPRADAQCWFADGKICQGGINPTFALMVCLALLIAL
LSINGFAYFIRHRINKIQLIKGPNRILLTLEDVTFINPHFGSKRGSHASVSFQITSEVQS
GRSPRLSFSSGSLTPATCENSNIAIYEGDWVWLKKFPSGNFGDIKSVESSASDIFEMMKD
LRHENINPLVGFFYDSGVFAIVTEFCSRRSLEDILMNQDVKLDWMFKSSLLLDLIKGMKY
LHHREFAHGRLKSRNCVVDGRFVLKVTDYGFNDILETLRLSQEEPSAEELLWTAPELLRA
PRGSRLRSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAKEIIERIKKPPPVYRPVVPPEHA
PPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIQ
ERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMS
EPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGMRHAAEIANMSLDI
LSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPY
RIHVSHSTVTILRTLGEGYEVELRGRTELKGKGTEETFWLVGKKGFTKPLPVPPPAGKDG
QVGHGLQSVEIAAFQRRKQKSSW
Download sequence
Identical sequences F1MRI0
ENSBTAP00000036727 ENSBTAP00000036727 XP_015317063.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]