SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036729 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036729
Domain Number 1 Region: 22-162
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 136-322
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-37
Family Laminin G-like module 0.0071
Further Details:      
 
Domain Number 3 Region: 321-503
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.78e-37
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 4 Region: 707-733,768-921
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-35
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 5 Region: 952-1156
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.79e-30
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 6 Region: 563-621
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000583
Family Fibrinogen C-terminal domain-like 0.0032
Further Details:      
 
Domain Number 7 Region: 534-570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000101
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036729   Gene: ENSBTAG00000026004   Transcript: ENSBTAT00000036878
Sequence length 1291
Comment pep:known chromosome:UMD3.1:18:3505270:3744371:1 gene:ENSBTAG00000026004 transcript:ENSBTAT00000036878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNLNVEFFLLADNCDDPLVSTLSQASFSSSSELSSSHGPGFARLNRRDGAGGWSPLVSNK
YQWLQIDLGERMEITAVATQGGYGSSNWVTSYLLMFSDSGRNWKQYRQEDSIWGFVGNAN
ADSVVYYRLQPSIKARFLRFIPLEWNPKGRIGMRIEVFGCAYRSEVVDLDGKSCLLYRFD
QKSLSPIKDVISLKFKTMQSDGILLHREGQNGDHITLELRRGKLFLLINSGDAKPPSARA
PVRLTLGSLLDDQHWHSVLIQRLGTQVNFTVDGHRRRFRAQGEFSSLHLDYEISFGGIPA
PGKPVSFPHKHFHGCLENLFYDGVDIIDLAKRQDPQMIVMGNVSFSCSQPQSVPVTFLSP
RSYLALPGSFGEDEISATFQFRTWNKAGLLLFTELQLVSGGLLLFLNDGKLKLHLYHPGK
LPSDITAGVGLNDGQWHSVSLSAKRNYLSVVVDGQVASASPSQGPEQIYSGGIFYFGGCP
DSSFGSKCKSPLGGFQGCMRLISIRHEVVDLISLQPGALGNFSDLQIDSCGITDRCLPNY
CEHGGECSQSWDTFHCNCANTGYRGATCHNSIYEQSCEAYKHKGNTSGFYYIDADGSGPL
EPFLLYCNMTETAWTIIQHNGSGVTRVRNTNPENPYTGFFEYVASMEQLQATINRAEHCE
QELTYYCKKSRLVSKEDGAPLSWWVGRTNETQTYWGGSLPDPQKCTCGLEGNCVDSQYYC
NCDADRNEWTNDTGFLSYKEHLPVTRIVITDTGRPHSEAAYKLGPLLCRGDKLFWNSASF
NTEASYLHFPTFHGELSADVSFFFKTTASSGVFLENLGITDFIRIELRSPAVVTFSFDVG
NGPFEISVQSPTHFSDNQWHHVRVERNMKEASVRVDQLSPKTQPAPADGHVLLQLNSQLF
VGGTATRQRGFLGCIRSLQLNGEALDLEERARVTPGVEPGCRGHCSSYGRLCHHGGMCME
KPSGFSCDCTSSAYAGPFCSDEISAYFGSGSSVIYNFQENYSLSKNSSSHAASFHGDTRL
SRETIKFSFRTTRTPSLLLYLSSFYKEYLSVILAKNGSLQIRYKLNRYQEPDVVNFDFKN
MADGQLHHVKINREEAVVFVEIDESMRRQVHLASGTELSAVRSLVLGRIIEHSDVDQETA
LAGAQGFLGCLSAVQVSHVAPLKAALQPSRPAPITVSGHVTESSCVAQAGTDATSRERTH
SFADHSGTRDDREPLTKTIKSDSAVIGGLIAVVIFILLCIAAIAVRIYQQKRLYKRNEAK
RSENVDNAEAVLKSELNIQNPVKENQKEYFF
Download sequence
Identical sequences G5E5W4
ENSBTAP00000036729 ENSBTAP00000036729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]