SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036815 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000036815
Domain Number - Region: 232-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0036
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 478-611
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00581
Family Growth factor receptor domain 0.006
Further Details:      
 
Domain Number - Region: 666-699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 619-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0147
Family EGF-type module 0.072
Further Details:      
 
Domain Number - Region: 59-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family Laminin-type module 0.067
Further Details:      
 
Domain Number - Region: 12-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0324
Family Laminin-type module 0.061
Further Details:      
 
Domain Number - Region: 100-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 449-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0492
Family Laminin-type module 0.059
Further Details:      
 
Domain Number - Region: 316-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0703
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036815   Gene: ENSBTAG00000034140   Transcript: ENSBTAT00000036967
Sequence length 963
Comment pep:known_by_projection chromosome:UMD3.1:10:12721325:12807326:-1 gene:ENSBTAG00000034140 transcript:ENSBTAT00000036967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLLCQ
CRHGASCDPQTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACP
PGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPLGTF
GFQCSQRCDCHNGGQCSPTSGACECEPGYKGPRCQERLCPEGLHGPGCSLPCPCDADNTI
SCHPVTGACTCQPGWSGYHCNESCPVGYYGDGCQLPCTCQNGADCHSITGSCTCAPGFMG
EVCAAPCAVGTYGSNCSSVCSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCN
ESCACANGAACSPTDGSCSCTPGWLGDTCELPCPDGTFGLNCSERCDCSHADGCDPVTGH
CCCLAGWTGIHCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRVCA
PGFYGHGCTQPCPLCVHSSGPCHHVSGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCA
NNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHTCSCHNGASCSAEDGACHCTPG
WTGLFCTQRCPAAFYGKDCGRVCQCQNGASCDHISGKCTCRTGFTGEHCEQRCAPGTFGY
GCQQLCECMNNATCDHVTGTCYCSSGFKGIRCDQAALMMEELNPYTKISPALGAERHSVG
AVTGIVLLLFLIVVLLGLFAWRRRRQKQKGRDLAPRVSYTPAMRMTSTDYSLSDLSQSSS
HAQCFSNSSYHALACGGPATSQASTLDRNSPTKLSNKSLDRDTAGWTPYSYVNVLVDSHF
QISALEARYPPEDFYIELRHLSRPAELHSPGACGTDRRQNTYVMDKGFKDYMKESVCSSS
TCSLNSSENPYATIKDPPILTCKLPESSYEEMKSPVHRGSPYTDVPSLSTSNKNIYEVGR
CLK
Download sequence
Identical sequences F1MRL6
9913.ENSBTAP00000036815 ENSBTAP00000036815 ENSBTAP00000036815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]