SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036821 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036821
Domain Number 1 Region: 1021-1358
Classification Level Classification E-value
Superfamily NHL repeat 5.49e-22
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1256-1492
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000118
Family SGL-like 0.038
Further Details:      
 
Domain Number 3 Region: 459-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000385
Family EGF-type module 0.081
Further Details:      
 
Domain Number 4 Region: 717-788
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000785
Family Carboxypeptidase regulatory domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000036821
Domain Number - Region: 428-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000439
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 557-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000559
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 525-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000878
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 393-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00148
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 590-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00172
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 363-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0339
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 493-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0718
Family Integrin beta EGF-like domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036821   Gene: ENSBTAG00000018819   Transcript: ENSBTAT00000036973
Sequence length 2560
Comment pep:known_by_projection chromosome:UMD3.1:X:8278045:8695188:-1 gene:ENSBTAG00000018819 transcript:ENSBTAT00000036973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLDMQSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPP
TSTQDSVHLHNSWVLNSNIPLETSRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRP
LPRSTFSRPAFTFSKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPAEG
QLYENGVSKGNRGTESMDTTYSPIGGKVSDKSEKKEPVFQKGRAIDTGEVDIGAQVMQTI
PPGLFWRFQITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQD
SRSSDDTQHSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDC
STNCNGNGECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRNGWKGPECDVP
EEQCIDPTCFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSGHGICVKGECHCSTGWGG
VNCETPLPICQEQCSGHGTFLLETGTCSCDPKWTGADCSTELCTMECGSHGVCARGICQC
EEGWVGPTCEERSCHSHCAEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGN
GRCTLDQNGWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYVSP
LCQGSPDPLDLIQQSQSLLSQHTLRLFYDRIKFLIGKDSTHVIPPEISFDSRRACVIRGQ
VVAVDGTPLVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVVLIFDRSPFLPEKRTLW
LPWNQFIVVEKVTMQRVMSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQV
VQEEILIPSSFVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGRLTQKWFP
AAVNLVYTFAWNKTDIYGQKVWGLAEALVSVGYEYEMCPDFILWEKRTVILQGFEMDASN
LGGWSLNKHHILNPQSGIIHKGNGENMFISQQPPVIATIMGNGHQRSVACTNCNGPAHNN
KLFAPVALASGPDGSVYVGDFNFVRRIFPSGNSVSILELRNRDTRHSTSPAHKYYLAMDP
MSESLYLSDTNTRKVYKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASL
NSPRGITVDRHGFIYFVDGTMIRRIDENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLE
WPTDLAVNPMDNSLYVLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTL
ESARAISVSHSGLLFIAETDERKVNRIQQVTTNGEISIIAGAPTDCDCKIDPNCDCFSGD
GGYAKDAKMKAPSSLAVSPDGTLYVADLGNVRIRTISRNQAHLNDMNLYEIASPADQELY
QFTVNGTHLHTLNLITRDYVYNFTYNAEGDLGAITSSNGNSVHIRRDASGMPLWLVVPGG
QVYWLTISSNGVLKRVSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNAT
FPTGDVSSFHSDLEKLTKVELDTSNRENVLMSTNLTATSTIYILKQENTQSTYRVSPDGS
LRVTFASGMEISLSSEPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQNKGNISAF
ERRLRAHNRNLLSIDFDHMTRTGKIYDDHRKFTLRILYDQTGRPVLWSPVSRYNEVNITY
SPSGLVTFIQRGTWNEKMEYDQSGKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEY
DQSDCLLSVTMPSMVRHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTG
RRVLYKYTKQARLSEILYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQ
IFRFSEEGLVNARFDYSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINY
DLNQVITTTVMKHTKIFSANGQVIEVQYEILKAIAYWMTIQYDNMGRMVICDIRVGVDAN
ITRYFYEYDADGQLQTVSVNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRL
GEIQYKMDEDGFLRQRGNDVFEYNSNGLLQKAYNKASGWTVQYYYDGLGRRVASKSSPGQ
HLQFFYADLANPIRVTHLYNHTSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLA
VFSSRGQVIKEILYTPYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDVIAGRW
TTPNHHIWKQLNLLPKPFNLYSFENNYPVGKIQDVAKYTTDIGSWLELFGFQLHNVLPGF
PKPELENLELTYELLQLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYGDGR
CLEGGKQPRFAAVPSVFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHF
TIEGRDTHYFIKLGSLEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQ
HGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLL
STGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences G5E5W9
ENSBTAP00000036821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]