SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036910 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036910
Domain Number 1 Region: 30-199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-60
Family SPRY domain 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036910   Gene: ENSBTAG00000026163   Transcript: ENSBTAT00000037068
Sequence length 204
Comment pep:novel chromosome:UMD3.1:23:26354054:26354780:-1 gene:ENSBTAG00000026163 transcript:ENSBTAT00000037068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYVHLFLADWRKEEFQTGESIMVQDRPCSLWVVPVNLTLDAATAHPALFLSEEGRRVTWQ
EPCQDLPSCPERFVSRPCVLGQLHVSSGRYFWEVEVQNAHSWDLGVCRNNVARNEMVTMS
PQNGFWAIRLYDGEYWVLTTPETSLTLKEKPLRVGVFLDYEARDVSFYNMTDGSHIYTFS
NQTFYGVLRPLFRLWSSDSGSLTI
Download sequence
Identical sequences F1MRF8
ENSBTAP00000036910 ENSBTAP00000036910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]