SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037062 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037062
Domain Number 1 Region: 46-243
Classification Level Classification E-value
Superfamily L domain-like 4.25e-40
Family Internalin LRR domain 0.017
Further Details:      
 
Domain Number 2 Region: 545-654
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-24
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037062   Gene: ENSBTAG00000003160   Transcript: ENSBTAT00000037224
Sequence length 658
Comment pep:known_by_projection chromosome:UMD3.1:25:36507967:36518507:1 gene:ENSBTAG00000003160 transcript:ENSBTAT00000037224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAAPLAAGGEEAAATTSVPGSPGLPGSRSAERALEEAVATGTLNLSNRRLKHFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLRCLNPALGNLTALTYLN
LSRNQLSSLPPYICQLPLRVLIVSNNKLGALPPDISALGSLRQLDVSSNELQSLPTELCS
LPTLRDLNVRRNQLSTLPDELGDLPLVRLDFSCNRVSRIPVSFCRLRHLQVILLDSNPLQ
SPPAQICLKGKLHIFKYLSTEAGRRGGSALGDLAPSRPPSFSPCPAEDLFPGRRYDGGLD
SGFHSVDSGSKRWSGNESTDEFSELSFRISELAREPRGPRERKEDGSADGDPEQIDFIDS
HVPGEDEERGTGEEPRPPESSPAAGDGERAPSSRREEPAGEERRRPDTLQLWQERERRQQ
QQQQQSVVWGAPRKDSFLKLGVRAAGGGPGASSTQATYNGTSRSNTTQLGASAGQGAPTP
ALASTSQEPPLPSGPATAPAPRPLSSIQRPNSFLFRSSSQSSSGPSSPDTVSRPRRSPQL
LDEKEVMAQLRQVLECQLQRPLPDDLAEALANGVILCQLANQLRPRCVPFIHVPSPAVPK
LSALKSRKNVESFLEACRKMGVPEESLCQPHHILEEEGAPGKGLPYVAAVIHALLERP
Download sequence
Identical sequences F1MV58
ENSBTAP00000037062 9913.ENSBTAP00000037062 ENSBTAP00000037062 XP_015315957.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]