SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037070 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037070
Domain Number 1 Region: 609-886
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.47e-79
Family Protein kinases, catalytic subunit 0.00000000064
Further Details:      
 
Domain Number 2 Region: 17-196
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-62
Family Ephrin receptor ligand binding domain 0.0000000107
Further Details:      
 
Domain Number 3 Region: 322-527
Classification Level Classification E-value
Superfamily Fibronectin type III 5.85e-32
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 4 Region: 905-974
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.53e-19
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Domain Number 5 Region: 251-320,361-374
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000471
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037070   Gene: ENSBTAG00000003446   Transcript: ENSBTAT00000037233
Sequence length 987
Comment pep:known chromosome:UMD3.1:25:36347294:36362877:1 gene:ENSBTAG00000003446 transcript:ENSBTAT00000037233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRALLCWASLAAALEETLLNTKLETADLKWVTFPQADGQWEELSGLDEEQHSVRTYEV
CDMQRAPGLAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYFESDA
DTATAHTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLTKAGFYLAFQD
QGACMALLSLHLFYKKCAQQTVNLTYFPETVPRELVVPVAGSCVADAMPAPGPSPSLYCR
EDGQWAEQPVTGCSCNAGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNAIGSS
ICQCRIGYFRASTDPRSAPCTTPPSAPRSVVPRLNGSALRLEWSAPLESGGREDLTYALR
CRECRPGGSCTPCGGDLTFDPGPRDLVEPWVAIRGLRPDVTYTFEVTALNGVSSLASGPV
PFEAVNVTTDREVPPPVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPS
SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDENEAWREQLAL
IAGTAVVGVVLVFVVIVIAVLCLRKQSNGREAEYSDKHAQYLIGHGTKVYIDPFTYEDPN
EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE
FLSEASIMGQFEHPNIIRLEGVVTNSVPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM
LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG
KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD
QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISTEDLLRIGVTLAGHQKK
ILASVQHMKSQAKPGAPGGSGAPAPQY
Download sequence
Identical sequences E1BIE4
ENSBTAP00000037070 ENSBTAP00000037070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]