SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037239 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037239
Domain Number 1 Region: 298-480
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-40
Family SPRY domain 0.00013
Further Details:      
 
Domain Number 2 Region: 9-83
Classification Level Classification E-value
Superfamily RING/U-box 1.03e-18
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 3 Region: 77-138
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000229
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037239   Gene: ENSBTAG00000001503   Transcript: ENSBTAT00000037406
Sequence length 493
Comment pep:known_by_projection chromosome:UMD3.1:25:27552790:27561099:1 gene:ENSBTAG00000001503 transcript:ENSBTAT00000037406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAMSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLSRVAGEPAADGTVLCPSCQA
PTRPQALSTNLQLARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHR
LLPAAEAHARLKERLSSSIFICKKRMRDKKPGVGQNTWVLGEEEGFVWFVHAEEDIFIQL
PTLRTRETLAALEGSLDREAERVRGEAGVALRRELGSLNSYLEQLRQMEKVLEEVADKPQ
TEFLMKYCLVTSSWTLSQEKALKKYCKPNPNRRALNQDDFKFQVWRKMFRALMPVAARQE
LTFDPSTAHPSLVLSNSGRCVECSEQKAPPAGEDPRQFDKAVAVVTHQLLSEGEHYWEVE
VGDKPRWALGVIGAQAGRRGRLHAVPSQGLWLLGLRDGKILEAHVEAKEPRALRTPERRP
TRIGIYLSFGDGVLSFYDASDPDALELLFAFHERLPGPVYPFFDVCWHDKGKNAQPLLLV
GPEPPGPFRLGGP
Download sequence
Identical sequences E1BE77
ENSBTAP00000037239 ENSBTAP00000037239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]