SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037404 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037404
Domain Number 1 Region: 43-135
Classification Level Classification E-value
Superfamily Myosin phosphatase inhibitor 17kDa protein, CPI-17 1.14e-29
Family Myosin phosphatase inhibitor 17kDa protein, CPI-17 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037404   Gene: ENSBTAG00000032450   Transcript: ENSBTAT00000037576
Sequence length 142
Comment pep:novel chromosome:UMD3.1:X:57583910:57584338:1 gene:ENSBTAG00000032450 transcript:ENSBTAT00000037576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAVADSGPGPRTGEWRPKGPASTFRAPLGLQGRVRGARINKDPVRPQGKVTVKYYRKEL
RKRLILEEWVLEQLTHLYDCQEEEIPELEIDGDELPVTESDNTRAARVKELLVDCYKPTE
AFISDLLDKIRGMQKLSTPQKK
Download sequence
Identical sequences E1B7I6
ENSBTAP00000037404 ENSBTAP00000037404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]