SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037465 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037465
Domain Number 1 Region: 774-882
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-24
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 254-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-19
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 6-138
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 217-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000127
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 616-771
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000055
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 137-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.021
Further Details:      
 
Domain Number 7 Region: 178-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000692
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037465   Gene: ENSBTAG00000011275   Transcript: ENSBTAT00000037639
Sequence length 960
Comment pep:known_by_projection chromosome:UMD3.1:5:114644629:114767260:-1 gene:ENSBTAG00000011275 transcript:ENSBTAT00000037639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAVDVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYKGEGRQCEDIDECENDHYNGGCV
HECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNGGCQQICVNAMGSYECQCHSGFF
LSDNQHTCIHRSSEGMNCMNKDHGCAHICRETPKGGVACDCRPGFDLAQNQKDCTLTCNY
GNGGCQHSCEDTDTGPTCGCHQKYALHSDGRTCIETCAVNNGGCDRTCKDTATGVRCSCP
VGFTLQPDGKTCKDINECLVNNGGCDHFCRNTVGSFECGCRKGYKLLTDERTCQDIDECS
FERTCDHTCINSPGSFQCLCHRGYTLYGTTHCGDVDECSMNNGSCDQGCVNTKGGYECVC
PPGRRLHWNRKDCVETGRCLSRAKASPPAQLSCGKAGSVESCSLACPGHTLFTPDSDNSY
SLSCGVPSLQGKALQKRNGTSSSTGPSCSGAPATLIRQKARFKIRDAKCHLRPRSQEPAK
EAPRQLLLENCHMTFVTLKCDSSKKRRRGRKSPSKEVTHITAEFEVETKVEEASDTCEAD
CVRRRAEQSLQAAIKTLRKSLSRQHFSVQVAGTEYELAQRPAKAPEGPGTCGPGHTPQDG
KCVACGPGTYFSGEPGQCVPCPPGTYQDRVGQLSCTPCPSSDGLGLAGARNVSECGGQCS
PGSFSTDGFRPCQACPMGTYQPEPGRTGCFPCGGGLLTKHEGSASFQDCEAKVHCSPGHH
YNTTTHRCIRCPVGTYQPEFGQNHCITCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGY
IESPNYPGDYPANAECVWHISPPPKRRILVVVPEIFLPIEDECGDVLVMRKSASPTSITT
YETCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLY
ASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences F1MJF1
ENSBTAP00000037465 ENSBTAP00000037465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]