SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037502 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037502
Domain Number 1 Region: 175-324
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.32e-43
Family Mannose 6-phosphate receptor domain 0.0000000373
Further Details:      
 
Domain Number 2 Region: 635-769
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.24e-38
Family Mannose 6-phosphate receptor domain 0.0004
Further Details:      
 
Domain Number 3 Region: 1524-1655
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.06e-36
Family Mannose 6-phosphate receptor domain 0.000000219
Further Details:      
 
Domain Number 4 Region: 1373-1515
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-35
Family Mannose 6-phosphate receptor domain 0.00071
Further Details:      
 
Domain Number 5 Region: 328-475
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-35
Family Mannose 6-phosphate receptor domain 0.000000156
Further Details:      
 
Domain Number 6 Region: 53-172
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.19e-34
Family Mannose 6-phosphate receptor domain 0.000000209
Further Details:      
 
Domain Number 7 Region: 767-931
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.79e-33
Family Mannose 6-phosphate receptor domain 0.0042
Further Details:      
 
Domain Number 8 Region: 1077-1227
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.06e-31
Family Mannose 6-phosphate receptor domain 0.00092
Further Details:      
 
Domain Number 9 Region: 2141-2288
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-30
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 10 Region: 1995-2134
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.01e-30
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 11 Region: 1232-1371
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.27e-30
Family Mannose 6-phosphate receptor domain 0.00017
Further Details:      
 
Domain Number 12 Region: 1660-1805
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.58e-30
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 13 Region: 942-1086
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-23
Family Mannose 6-phosphate receptor domain 0.0031
Further Details:      
 
Domain Number 14 Region: 1808-1903,1954-1997
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.88e-22
Family Mannose 6-phosphate receptor domain 0.0017
Further Details:      
 
Domain Number 15 Region: 1903-1953
Classification Level Classification E-value
Superfamily Kringle-like 6e-17
Family Fibronectin type II module 0.0013
Further Details:      
 
Domain Number 16 Region: 523-630
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000101
Family Mannose 6-phosphate receptor domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037502   Gene: ENSBTAG00000002402   Transcript: ENSBTAT00000037678
Sequence length 2499
Comment pep:known chromosome:UMD3.1:9:97638172:97740003:1 gene:ENSBTAG00000002402 transcript:ENSBTAT00000037678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAAGRSSHLGPAPAGRPPRCPLLLQLQLLLLLLLLPPGWVPGAAGTQGAEFPELCSYT
WEAVDTKNNMLYKINICGNMGVAQCGPSSAVCMHDLKTDSFHSVGDSLLKTASRSLLEFN
TTVNCKQQNHKIQSSITFLCGKTLGTPEFVTATDCVHYFEWRTTAACKKNIFKANKEVPC
YAFDRELKKHDLNPLIKTSGAYLVDDSDPDTSLFINVCRDIEVLRASSPQVRVCPTGAAA
CLVRGDRAFDVGRPQEGLKLVSNDRLVLSYVKEGAGQPDFCDGHSPAVTITFVCPSERRE
GTIPKLTAKSNCRFEIEWVTEYACHRDYLESRSCSLSSAQHDVAVDLQPLSRVEASDSLF
YTSEADEYTYYLSICGGSQAPICNKKDAAVCQVKKADSTQVKVAGRPQNLTLRYSDGDLT
LIYFGGEECSSGFQRMSVINFECNQTAANGGHTHPVFVGKIPCRRFPWWRGRGACVRRKA
PRLGGSNDHPQRPQEDSQERPGSRARKLESPSGLETGKTIRALFVRICSTLLQSCPTRCH
PIDGSLCLLDKRNNRMLGRPWQEPGRPRAELNISFLSGGRRNKSAQIFTSIQLVWEPCDL
ESAPVLTTSRADGCFYEFEWRTAAACVLSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKV
ETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDG
TPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECIVTDP
VTLDQYDLSRLAKSEGGPGGNWYSLDNGGARSTWRKYYINVCRPLNPVPGCDRYASACQM
KYQGEQGSYSETVSISNLGVAKTGPMVEDSGSLLLEYVNGSACTTSDQRRTTYTTRIHLV
CSTGSLYTHPIFSLNWECVVSFLWNTAAACPIRITTDIDQVCSIKDPNSGYVFDLNPLNN
SRGYVVLGIGKTFLFNVCGDMPACGTLDGKPASGCEAEVQMDDMKTLKPGRLVGLEKSLQ
LSTEGFITLNYTGLPSHPNGRADAFIIRFVCNDDVYPGTPKFLHQDIDSSLGIRDTFFEF
ETALACVPSPVDCQVTDPAGNEYDLSGLSKARKPWTAVDTFDEGKKRTFYLSVCTPLPYI
PGCHGTAVGSCLVTEDSKLNLGVVQISPQVGANGSLSLVYVNGDKCKNQRFSTRINLECA
HTTGSPTFQLQNDCEYVFLWRTVEACPVVRAEGDYCEVRDPRHGNLYNLIPLGLNDTVVR
AGEYTYYFRVCGELTSGVCPTSDKSKVISSCQEKRGPQGFQKVAGLFNQKLTYENGVLKM
NYTGGDTCHKVYQRSTTIFFYCDRSTQAPVFLQETSDCSYLFEWRTQYACPPYDLTECSF
KNEAGETYDLSSLSRYSDNWEAVTGTGSTEHYLINVCKSLSPQAGSDPCPPEAAVCLLGG
PKPVNLGRVRDSPQWSQGLTLLKYVDGDLCPDQIRKKSTTIRFTCSESHVNSRPMFISAV
EDCEYTFSWPTAAACAVKSNVHDDCQVTNPATGHLFDLSSLSGRAGFTAAYSEKGLVYLS
VCGDNENCANGVGACFGQTRISVGKASKRLTYVDQVLQLVYEGGSPCPSKTGLSYKSVIS
FVCRPEVGPTNRPMLISLDKRTCTLFFSWHTPLACEQTTECSVRNGSSLIDLSPLIHRTG
GYEAYDESEDDGSDTSPDFYINICQPLNPMHGLACPAGTAVCKVPVDGPPIDIGRVAGPP
ILNPIANEVYLNFESSTPCLADRHFNYTSLITFHCKRGVSMGTPKLLRTSVCDFVFEWET
PLVCPDEVKTDGCSLTDEQLYYSFNLSSLSKSTFKVTRGPHTYSVGVCTAAAGLDEGGCK
DGAVCLLSGSKGASFGRLASMKLDYRHQDEAVILSYANGDTCPPETEDGEPCVFPFVFNG
KSYEECVVESRARLWCATTANYDRDHEWGFCKHSTSHRTSVIIFKCDEDADVGRPQVFSE
VRGCEVTFEWKTKVVCPPKKMECKFVQKHRTYDLRLLSSLTGSWSFVHNGASYYINLCQK
IYKGPQDCSERASVCKKSTSGEVQVLGLVHTQKLDVVDDRVIVTYSKGHYCGDNKTASAV
IELTCAKTVGRPSFTRFDVDSCTYHFSWDSRAACAVKPQEVQMVNGTITNPANGRSFSLG
DIYFKRFSASGDVRTNGDRYIYEIQLSSIMGSSSPACSGASICQRKANDQHFSRKVGTSN
QTRYYVQDGDLDVVFTSSSKCGKDKTKSVSSTIFFHCDPLVKDGIPEFSHETADCQYLFS
WHTSAVCPLGAGFDEEIAGDDAQEHKGLSERSQAVGAVLSLLLVALTACLLTLLLYKKER
REMVMSRLTNCCRRSANVSYKYSKVNKEEEADENETEWLMEEIQPPAPRPGKEGQENGHV
AAKSVRAADTLSALHGDEQDSEDEVLTLPEVKVRPPGRAPGAEGGPPLRPLPRKAPPPLR
ADDRVGLVRGEPARRGRPRAAATPISTFHDDSDEDLLHV
Download sequence
Identical sequences F1MIE6
ENSBTAP00000037502 ENSBTAP00000037502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]