SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037559 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037559
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-31
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 2 Region: 830-1109
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000165
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number 3 Region: 134-311
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000507
Family Pentraxin (pentaxin) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037559   Gene: ENSBTAG00000020707   Transcript: ENSBTAT00000037735
Sequence length 1190
Comment pep:known_by_projection chromosome:UMD3.1:9:80875767:80955823:1 gene:ENSBTAG00000020707 transcript:ENSBTAT00000037735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVWACANCRVVLSNPSGTFTSPCYPNDYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPN
CIYDSLSLDNGESQTKFCGATAKGLSFNSSVNEMHVSFSSDFSIQKKGFNASYVRVAVSL
RNQKVILPQSLDSYQVSVAKSVSIPELRAFTLCFEATKIGKEDSEWTAFSYSDASFPQLL
SFGKTKSGYFLSFFGSKCLLNSALPVKDKEDIFTESFEQLCIAWSSSLGSVGVNFKRNYG
TVSCNSSMGKVIPGNGKLLLGSNQHDIGSLKGDIYNFRLWNFTISSKILSNLSCSVKGNV
VDWQNDFWNIPTLALKAESNLSCDQGSYLIPLPAAELASCADLGTLCQATVNPPSTTSPT
VTTNMPVTNRTDKQRNDGIIYRISIVLQNILPHPEVKVQSKVAEWLNSTFQNWNYTVYVV
NISFHLSTGEDKIKVRRSVVTDQRLVILALLVYNATNNPTLEGRTIQQKLLRNNESLDEG
LRLHKVNVRQLGVCHADEKPKGYKWPSIQPSEYRTPCLGKPGFFASRTCYDDPNNTSVAI
WGLPDISNCSREANEVANEILNLTSDGQTLSSANITSIVEKVKRIVNEKENIDITLGSTL
MNIFSNILTSPDSDLLESSSEALKTIDELAFKIDLQSTTHMNITTQNLALGVSSVSPETN
EVSNFSIGLPSNNESYFQMDFKSGQMDPLASVILPPNLLKNLSEEDSVLVKRAQFTFFNK
TGLFQDVGTKKGTLVSYVMACSIGNITIQGLKDPVQIKIKHTRTQAMAHPICAFWDLNKN
ESSGFWNTSGCVAHKDSDANETVCLCNHLTHFGVLMDLQGTASQLDAKNTKILTFITYIG
CGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSTALLFLNLVFLLDRWITSFHVDGLCT
AIAALLHFFLLAAFTWMGLEAIHMYIALVKVFNTYIRRYILKFCIVGWGVPILVVSIVLA
SRKQNEVYGKKSYGREQGDEFCWIQDPVVFYVTCAGYFGLMFFLNVAMFIVVMVQICGRN
GKRSSRTLREEVLRNLRSVVSLTFLLGMTWGFSFFAWGPLNVPFMYLFSIFNSLQGLFIF
IFHCAMKENVQKQWRRHLCCGRFRLADNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNST
YLTSKSKSSSTTYFKRNSHTVDCQQDHSFNKSGSFRQCFHGQVLIKTDSC
Download sequence
Identical sequences F1MJV6
ENSBTAP00000037559 9913.ENSBTAP00000037559 ENSBTAP00000037559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]