SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037611 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037611
Domain Number 1 Region: 600-885
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-81
Family Protein kinases, catalytic subunit 0.00000000326
Further Details:      
 
Domain Number 2 Region: 4-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.19e-69
Family Ephrin receptor ligand binding domain 0.00000187
Further Details:      
 
Domain Number 3 Region: 299-506
Classification Level Classification E-value
Superfamily Fibronectin type III 6.65e-40
Family Fibronectin type III 0.00000376
Further Details:      
 
Domain Number 4 Region: 905-972
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.17e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 
Domain Number 5 Region: 227-296,347-360
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000361
Family Growth factor receptor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037611   Gene: ENSBTAG00000020102   Transcript: ENSBTAT00000037789
Sequence length 976
Comment pep:known_by_projection chromosome:UMD3.1:2:130830285:130858979:-1 gene:ENSBTAG00000020102 transcript:ENSBTAT00000037789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLNLLDTSTIHGDWGWLTYPAHGWDSINEVDESFQPIHTYQVCNVMSPNQNNWLRTSWV
PRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQESQFLKIDTIA
ADESFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPTMVR
NLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEER
RDACVACELGFYKSAPGDQLCARCPPHSHSAAPAAQACRCDLSYYRAALDPPSAACTRPP
SAPVNLISSVNGTSVTLEWAPPLDRGGRSDITYNAVCRRCPWALGHCETCGSGTRFVPQQ
TSLVQASLLVANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITTNQAAPSQVVVIRQE
RAGQTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLKPGTRYV
FQVRARTSAGCGRFSQAMEVETGKPRPRYDTRTIVWICLTLITGLVVLLLLLICKKRHCG
YSKAFQHSDEEKMHYQNGQAPPPVFLPLHHPPGKIPEPKFYTEPHTYEEPGRTGRGFTRE
IEASRIHIEKIIGSGESGEVCYGRLRMPGQRDVPVAIKALKAGYTERQRRDFLSEASIMG
QFDHPNIIRLEGVVTRGRLAMIVTEYMENGSLDAFLRTHDGQFTIVQLVGMLRGVGAGMR
YLSDLGYVHRDLAARNVLVDGNLVCKVSDFGLSRVLEDDPDAAYTTTGGKIPIRWTAPEA
IAFRTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPHALHQ
LMLDCWHKDRAQRPRFSQIVSVLDSLIHSPESLRATATVHRCPPPAFARSCFDLRGGGGG
SGGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQ
TMRAQLTSTQGPRRHL
Download sequence
Identical sequences F1MKR1
ENSBTAP00000037611 ENSBTAP00000037611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]