SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037790 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037790
Domain Number 1 Region: 433-609
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-36
Family SPRY domain 0.0012
Further Details:      
 
Domain Number 2 Region: 56-131
Classification Level Classification E-value
Superfamily RING/U-box 1.08e-17
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 190-255
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000549
Family B-box zinc-binding domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037790   Gene: ENSBTAG00000026645   Transcript: ENSBTAT00000037969
Sequence length 616
Comment pep:known chromosome:UMD3.1:19:56993408:56999724:-1 gene:ENSBTAG00000026645 transcript:ENSBTAT00000037969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEQQPKGKGSKPLALLDMQRVSRPVQDQAPALQPTAKLSGAPQGQFLMNDSSLCTLEDQV
LCPVCLEVFRNPVTTACGHNFCMSCLQGFWDYQATMGEPLYCPQCRESFPTRPRLCKNVI
LEEMVTCFTQAKGQTLGSSRSLAGPRDVPCDFCAPEKLKSVKSCLQCMASLCEKHLRSHL
EDQVFHGHQLLEPVWDLKSRLCRKHRKLRRLYCRTEGCCVCGACLLEEHKNHDTIPLEEE
RARKEVEVRKVQANVENQMLIITSDSQKHRGQVAFLSKLIQTTRDEVNACFSEIIQEIKQ
MQMKVLDFVEKEEAAALGKLGGSIQQSHNRLLKLEGDSIWLRSLLANRSDQQFLQELPRL
KHFPACVEPLMGTNCEEKQSFLQLPETLAELRTRLVDMGLSFINQLLLKGIKMNSYEVLP
PDVDRKILLKCYCNLNFDATTASEELFLFKETHSVLNLGILLEPFAAGGPFPGFKQWPQV
LCSRGLAEGRHYWEADVSNSWVCLGVTYRRSPPLGGRPRRNIVYLLGRNPYSWCLEWDSL
KFSVWHNNTQTVLHGGYHRTLGVLLDCAAGCLSFYGVAGGVSLLYRFLASFLEPLYPAVM
VSSGASVTLKQRPSEA
Download sequence
Identical sequences Q1LZH3
ENSBTAP00000037790 ENSBTAP00000037790 9913.ENSBTAP00000037790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]