SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037826 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037826
Domain Number 1 Region: 36-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000104
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number 2 Region: 100-141
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000471
Family Fibronectin type I module 0.074
Further Details:      
 
Domain Number 3 Region: 194-238
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000549
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037826   Gene: ENSBTAG00000017205   Transcript: ENSBTAT00000038007
Sequence length 340
Comment pep:known_by_projection chromosome:UMD3.1:9:38847224:38856926:-1 gene:ENSBTAG00000017205 transcript:ENSBTAT00000038007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFCCRAQDAGLSDTAVKGSPAEGAEGHHRKQFCHWPCQCPRRKPSCPPGVSLVRDGCGC
CKICARQPGDTCNEADLCDPHKGLYCDYSADRPRYETGVCAYLIAVGCEFNGVHYQNGQV
FQPSPLFSCLCVSGAIGCTPLFIPKLAKRHCSGAKGGEKTDQSKCGLGSSQKQLSTSYKT
MPAYRNLPLIWKRKCLVQATKWTPCSRTCGMGISNRVTNENSNCEMGKEKRLCYIRPCDS
DISKTVKIPKGKTCQPTFQPVKAEKFVFSGCASTQSYRPTFCGICLDKRCCVPNKSKMIT
VQFDCPNEGSFKWKMLWITSCVCQRNCRDPEDIFSELKIL
Download sequence
Identical sequences E1B9N9
ENSBTAP00000037826 ENSBTAP00000037826 9913.ENSBTAP00000037826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]