SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038137 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038137
Domain Number 1 Region: 1972-2266
Classification Level Classification E-value
Superfamily BEACH domain 2.22e-121
Family BEACH domain 0.000000014
Further Details:      
 
Domain Number 2 Region: 2324-2554
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.63e-27
Family WD40-repeat 0.005
Further Details:      
 
Domain Number 3 Region: 1875-1971
Classification Level Classification E-value
Superfamily PH domain-like 5.72e-27
Family PreBEACH PH-like domain 0.0043
Further Details:      
 
Domain Number 4 Region: 4-548
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000019
Family Mo25 protein 0.06
Further Details:      
 
Domain Number 5 Region: 558-708
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000066
Family Laminin G-like module 0.053
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000038137
Domain Number - Region: 929-1198
Classification Level Classification E-value
Superfamily ARM repeat 0.0107
Family HEAT repeat 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038137   Gene: ENSBTAG00000014469   Transcript: ENSBTAT00000038322
Sequence length 2592
Comment pep:known chromosome:UMD3.1:2:91754398:91887415:1 gene:ENSBTAG00000014469 transcript:ENSBTAT00000038322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFLFQKDPDYLKLWLDSFVSSYEQFLDVDFEKLPTRVDDVPPGISLLPDNILQVLRIQL
LQCVQKMADGLEEEQQALSILLVKFFIILCRNLSNVEEIGTCSYINHVITMTTLYIQQLK
SKKKEKELADQTSIEEFVIHALAFCESLYDPYRNWRQRISGRIFSTVEKSRQKYKPASLT
VEFVPFFYQCFQESEHLKESLKCCLLHLFGAIVAGGQKNALQAISPATMEVLMRVLADCD
SWEDGNPEEVGRKVELTLKCLTEVVHILLTSSSDQRQVETSTILENYFKLLNSDHSALPN
QRRSRQWENRFIALQIKMLNTITAMLDCTDRPVLQAIFLNSNCFEHLIRLLQNCKVFQGQ
LDYLAVSAIQALTAVMNKSPAAKEVFKERIGYTHMFEVLKSLGQPPLELLKELMNMAVEG
DHTSVGILGISNVQPLLLLIQWLPELESHDLQVFISDWLKKICCINRQSRTTCVNANMGI
RIIEALNSHSCLHRTCAENLIALHGSLGSQSVSSEEIRQLLRLLRVDESESVHPYTTPVT
RAILTMARKQSLESALQYFNLSHSMAGISVPSIQKWPGSAFSFNAWFCLDQDQLTLGNAN
KGGKRKQLYSFFTGSGMGFEAFITHSGMLVVAVCTKREYATVMLPDHSFCDSLWHNITIV
HMPGKRPFGQSLVYIYDNGQQKVSAPLRFPAMNEPFISCCIGSAGQRTTTPPPSQIPDPP
FSSPITPHRTSFGGILSSASWGGTTEKSKLITKLISAGTQDSEWGCPTSLEGQLGSVIIF
YEALQPPQVKALYLAGPNCLSPWKFQESDMADLPGNVLLHYTAKACKNAICLDLSTNCFH
GRLTGNKVVNWDIKDVINCIGGLNVLFPLLEQISHFGEGQIPEGLNESTVSELITPVEGD
WVVLTSTKASESRLERNLIATFILIVKHFIQRHPINQDNLIHSHGVAVLGALLQKVPSAL
MDVNVLMAIQLLIEQVSLEKNMQLLQQMYQYLLFDFHIWNRGDFPFRIGHIQYLSTIIKD
SRRVFRKKYGVQFLLDTLRIYYGNDCKYNELSPDDIRTIRTSLYGLIKYFLSKGGTHEEI
QSIMGYIAAINEEEQLLGILDILFSLLRTSPNRGQLFLLLFEPGNADILYALLLNQKYSD
KLREIIFKVMEQMLKCTNVYERSKQRIRLREVGYSGFGLLLNEAPVNTSLIKSLTNQIIN
TDPAINFKDLLSVVYISHRAYINVRVVICRKMLQILQSQPDAAHQISQQVGWQDTLVKLF
LKANFENGNTLHKHNRAIIVKDNDKNISVEDMKRSFDEKTDEEKIASFASAHVSSDEWSL
EDRHSLDSNMPLFQEDSSMGELSFKSENQEEFWHNNPSPLSLDLSGIDSCELSDGGSQMP
DSLPSTPSPVESMKPFPVQPDKESSVTNDVGFSDDFSLLENKERCEEELIQLLTNILSCI
MCKGLEKSDDDTWIERGQVFSALTKPGISSELLRPSDEIKLVLLQKMLEWAVTENREAKM
NPVTAENAFRLTLIIQDFLQSEGLVNSNMWTEKLLEDLMLLFDSLSVWYSESPVGVKLSQ
IQIQLLLGFIGKGNLQVCAMASAKLNTLLQTKVIENQDEACYILGKLEHVLSQSIKEQTE
IYSFLIPLVRTLVSKIYELLFMNLHLPSLPLTNGSASFFEDFQEYCSSNEWQVYIEKYIV
PYMKKYETHTFYDSHESMALYWKDCYEALMVNMHKRDRDGGESKLKFQEFFVEPFNRKVR
QENLRYNNMLKQLSSQQLATLRRWKAVKLYLTCERGPWAKRQQNPIHWKLANVENYSRMR
LKLVPNYNFKTHEEASALRDNLGIQHSQPSSDSLLLEVVKQVKVSDMEEDKLDLPEEEIT
SRVNIDEKEEQNQKEKLVLSEDCELITIIDVIPGRLEITTQHIYFYDGSIEKEDGVGFDF
KWPHSQVREIHLRRYNLRRSALEIFHVDQSNYFLNFKKEVRNKVYSRLLSLHSPNSYGTR
SPQELFKASGLTQKWVNREISNFDYLIQLNTMAGRTYNDLAQYPVFPWILQDYTSEELDL
NNPSVFRDLSKPIGVVNDKNAKATREKYENFEDPMGTIDKFHYGTHYSNSAGVMHYLIRT
EPFTTLHIQLQSGRFDCADRQFHSIPATWQALMDNPYDVKELIPEFFYFPEFLENQNQFN
LGRLQVSKELVNDVVLPKWAKSAEDFICKHRKALESEYVSAHLHEWIDLIFGYKQRGPAA
VEALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQTPCQLLKITLSMNHIIGTHGW
LPYDRNISNYFTFIRDQTVTNPKTQRSMNGPFAPGLEITSKLFIVSHDAKLLFSAGHWDN
SIQVMSLTKGKLISHNIRHMDIVTCLATDYCGIHLISGSRDTTCMIWQITQQGGVPMGLA
SKPFQILYGHTDEVLSVAISTELDMAVSGSRDGTVIIHTIPNLAISWEGHIVMYSSIEES
TSLKDKNALHLFSVNGKYLGSQVLKEQVSDICIIGEHIVTGSLQGFLSIRDLHSLNLCIS
PLAMRSPIHCVCVTKEYSHILVGLEDGKLIVVGVGRPAEMRSGQLSRKLWGSSKRLSQIS
AGETEYNTQDSK
Download sequence
Identical sequences E1BC19
9913.ENSBTAP00000038137 ENSBTAP00000038137 NP_001096643.1.59421 NP_001096643.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]