SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038301 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038301
Domain Number 1 Region: 110-362
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.37e-79
Family Glutamine synthetase catalytic domain 0.0018
Further Details:      
 
Domain Number 2 Region: 17-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.2e-20
Family Glutamine synthetase, N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038301   Gene: ENSBTAG00000013631   Transcript: ENSBTAT00000038488
Sequence length 373
Comment pep:known chromosome:UMD3.1:16:64948332:64958885:-1 gene:ENSBTAG00000013631 transcript:ENSBTAT00000038488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSASSHLNKGIKQVYMALPQGDKVQAMYIWIDGTGEGLRCKTRTLDSEPKCIEELPEW
NFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRI
MDMVSNQRPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY
RACLYAGIKIGGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPFAVTEALIRTCL
LNETGDEPFQYKN
Download sequence
Identical sequences P15103
ENSBTAP00000038301 ENSBTAP00000038301 NP_001035564.1.59421 NP_001035564.1.76553 XP_005217320.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]