SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038330 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038330
Domain Number 1 Region: 36-109
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038330   Gene: ENSBTAG00000047248   Transcript: ENSBTAT00000038517
Sequence length 116
Comment pep:novel chromosome:UMD3.1:3:63013693:63014043:-1 gene:ENSBTAG00000047248 transcript:ENSBTAT00000038517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGA
NINEIRQMSRAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS
Download sequence
Identical sequences E1B8C6
ENSBTAP00000038330 ENSBTAP00000038330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]