SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038495 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038495
Domain Number 1 Region: 38-97
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000022
Family VWC domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038495   Gene: ENSBTAG00000027020   Transcript: ENSBTAT00000038684
Sequence length 1491
Comment pep:known_by_projection chromosome:UMD3.1:2:7139738:7298551:1 gene:ENSBTAG00000027020 transcript:ENSBTAT00000038684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANWVEARPLLILTVLLGQFVSIKAQEEDEDEGYGEEIACTQNGQMYLNRDIWKPAPCQI
CVCDNGAILCDKIQCQDVLECADPVTPPGECCPVCPHTTGGGNTNFGRGRKGQKGEPGLV
PVVTGIRGRPGPAGPPGSQGPRGERGPKGKPGPRGPQGIDGEPGVPGQPGAPGPPGHPSH
PGPDGMSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGVGPAGPPGE
PGDPGPMGPVGARGPEGPPGKPGEDGEPGRNGKPGEVGFAGSPGARGFPGAPGLPGLKGH
RGHKGLEGPKGEVGATGSKGEAGPTGPMGAMGPMGPRGMPGERGRLGPQGAPGQRGAHGM
PGKPGPMGPLGIPGSAGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSQGLPGA
VGTDGTPGAKGPTGSPGTSGPPGLAGPPGSPGPQGSTGPPGIRGQPGDPGVPGFKGEAGP
KGEPGPHGVQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERLPLFACIPFFPDVFYFALKQ
GAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRP
GPPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPP
GLAGERGEQGPPGPTGFQGLPGPPGPPGEAGKPGDQGVPGDPGAVGPLGPRGERGNPGER
GEPGITGLPGEKGMAGGHGPDGPKGSPGPPGTPGDTGPPGLQGMPGERGIAGTPGPKGDR
GGIGEKGAEGTAGNDGARGLPGPLGPPGPSGPTGEKGEPGPRGLVGPPGSRGNPGSRGEN
GPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGR
GTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPA
GPPGGPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKV
GPTGAPGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLP
GSQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRGLLNPNFPNFGKYLRFKILHF
SPNIXGPTGEQGSAGIPGPFGPRGPPGPVGPSGKEGSPGPLGPIGPPGVRGSVGEAGPEG
PPGEPGPPGPPGPPGHLTAALGDIMGHYDDSMPDPLPEFTEDQAAPDDKNKTDPGVHATL
KSLSSQIETMRSPDGSRKHPARTCDDLKLCHSAKKSVWKTGEYWIDPNQGSAEDAIKVYC
NMETGETCISANPSSVPRKTWWASKSPDNKPVWYGLDMNRGSQFVYGDHQSPNAAITQMT
FLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGSNDLEIKAEGNVRFRYIVLHD
SCSKRNGNVGKTIFEYRTQNVARLPIIDLAPVDVGSTDQEFGVEIGPVCFV
Download sequence
Identical sequences F1N2Y2
ENSBTAP00000038495 ENSBTAP00000038495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]