SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038650 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038650
Domain Number 1 Region: 38-281
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.39e-53
Family Ankyrin repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 280-322
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000484
Family SOCS box-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038650   Gene: ENSBTAG00000001514   Transcript: ENSBTAT00000038842
Sequence length 323
Comment pep:known chromosome:UMD3.1:X:135436138:135465103:1 gene:ENSBTAG00000001514 transcript:ENSBTAT00000038842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGSVSYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIFGEIS
DCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLEN
GAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGNRECME
ILLANNVNIDQEVPHLGTPLYAACTYQRLDCVKKLLELGANVNHGQWLDTPLHAAAKQNS
VEIIHLLIDYGANLKCKNAQGQSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLG
RNCHKTIHKLYLPDPLEKFLLYQ
Download sequence
Identical sequences L8I4J0 Q3SZE4
9913.ENSBTAP00000038650 ENSBTAP00000038650 NP_001029585.1.59421 NP_001029585.1.76553 XP_005903179.1.15283 ENSBTAP00000038650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]