SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000038763 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000038763
Domain Number 1 Region: 30-118
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.06e-32
Family Ribosomal L11/L12e N-terminal domain 0.0000091
Further Details:      
 
Domain Number 2 Region: 106-172
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.000000000000222
Family Ribosomal protein L11, C-terminal domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000038763   Gene: ENSBTAG00000027172   Transcript: ENSBTAT00000038959
Sequence length 192
Comment pep:novel chromosome:UMD3.1:3:30318709:30319287:1 gene:ENSBTAG00000027172 transcript:ENSBTAT00000038959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYSFQLSAGRRQRCNFLQLSQIQVHPTPAASTMPPKFDPNEINVVYLRCTSGEVGATSAL
APKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQYRQAQIQVVPSASALIIKALKEP
PRDRKKQKNIKHSGNITFDEIINTARQMWHRSLARELSGTIKEILGTTQSIGHHPHDVID
DINSGTVECTAS
Download sequence
Identical sequences F1N3R2
9913.ENSBTAP00000038763 ENSBTAP00000038763 ENSBTAP00000038763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]