SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039006 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039006
Domain Number 1 Region: 5-210
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.77e-79
Family Phosphoglycerate kinase 0.00000000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039006   Gene: ENSBTAG00000000894   Transcript: ENSBTAT00000039206
Sequence length 214
Comment pep:known chromosome:UMD3.1:X:79282708:79305316:-1 gene:ENSBTAG00000000894 transcript:ENSBTAT00000039206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKYCLDSGAKSVVL
MSHLGRPDGVPMPDKYSLQPVAVELKSLLGKDVLFLKDCVGPEVEKACADPAAGSVILLE
NLRFHVEEEGKGKDASGNKVKAEPTKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPKKAGGFLMKKELNYFAKALESPERPFLAPGRS
Download sequence
Identical sequences G3X7N4
ENSBTAP00000039006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]