SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039106 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039106
Domain Number 1 Region: 110-273
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.39e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00044
Further Details:      
 
Domain Number 2 Region: 289-382
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.61e-22
Family Pancreatic carboxypeptidases 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039106   Gene: ENSBTAG00000011458   Transcript: ENSBTAT00000039309
Sequence length 422
Comment pep:known chromosome:UMD3.1:13:52844204:52850549:1 gene:ENSBTAG00000011458 transcript:ENSBTAT00000039309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLLLALATFAPAVDVGLGAPSTSVLGLASPATTKVPVPTPHSSPAQPSAGKENGTSEQ
HVRIRVIKKKKIVMKKRKKLTRPTPPVTARPSVTTSPSGTLDLPEKQEPDCPPLGLESLR
VSDNQLDASSSQSFGLGPHRGRLNIQSGLEDGDLFDGAWCAEQQDAEPWLQVDARHPTRF
SGIITQGRNSIWRYDWVTSYKVQFSNDSRTWWGSKNRSSGMDAVFPANSDPETPVLNLLP
EPQVARFIRLLPQTWLQGGASCLRAEILACPVSDPNGLFPEVPMLGSSDSLDFRHHDYKA
MRKLMKQVNEQCPNITRIYSIGKSHQGLKLYVMEMSDQPGEHELGEPEVRYVAGMHGNEA
LGRELLLLLMQFLCHEFLRGSPLKRALCPAISASPRLPNRDFESCWQLGPRCPRTFGGGW
NG
Download sequence
Identical sequences Q58DP5
ENSBTAP00000039106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]