SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039209 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039209
Domain Number 1 Region: 19-222
Classification Level Classification E-value
Superfamily L domain-like 2.27e-42
Family Internalin LRR domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039209   Gene: ENSBTAG00000027446   Transcript: ENSBTAT00000039415
Sequence length 277
Comment pep:known chromosome:UMD3.1:13:31347074:31554426:-1 gene:ENSBTAG00000027446 transcript:ENSBTAT00000039415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSLKKLVEESREKNQPEVDMSDRGISNMLDINGLFTLSHITQLVLSHNKLTTVPPNIA
ELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNN
LNENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELT
QLKELHIQGNRLTVLPPELGNLDLTGQKQIFKAENNPWVTPIADQFQLGVSHVFEYIRSE
TYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNK
Download sequence
Identical sequences Q5E9C0
ENSBTAP00000039209 9913.ENSBTAP00000039209 ENSBTAP00000039209 NP_001035691.1.59421 NP_001035691.1.76553 XP_010858274.1.44457 XP_019828667.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]